CAZyme Information: MGYG000000815_00377

Basic Information

• Species: Dysgonomonas capnocytophagoides
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas capnocytophagoides
• CAZyme ID: MGYG000000815_00377
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
287		32258.76	6.8314

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000815	4510901	MAG	China	Asia

• Gene Location: Start: 448350; End: 449213 Strand: +

Full Sequence      

MKNLILIVSFFCCLSLSVNAQKGSVKSGKIYSRILGVDKEYSVYLPDGYETSGYKYPVLY
LLHGAWGNHTNWLNAGNLAFVADKTINEGFASQMVIVMPDARGKEDNFGGHHMGYFNYPD
WKYQEFFILEFLPAIEKEYRIKSDKQHRAIAGLSMGGGGSIILAQKYPDYFGSACSLSGA
LIASDEIPSRDVDADFLREMKNDDPTAFLHNADKETLSKLNSVRWYVDCGDKDFLSKGNV
LYFLAMKERGLSLEYRMRGGAHTWDYWQSGLVPVLQYISVGFMGGNK

Enzyme Prediction     

No EC number prediction in MGYG000000815_00377.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	32	277	6.9e-55	0.973568281938326

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	1.54e-35	39	278	35	308	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	6.03e-27	32	278	1	246	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	7.62e-25	29	277	72	294	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG4099	COG4099	3.55e-08	36	179	171	302	Predicted peptidase [General function prediction only].
TIGR01840	esterase_phb	6.45e-08	41	179	1	128	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXE20401.1	2.01e-30	23	275	147	394
QPH58958.1	2.07e-30	23	268	149	386
ASV29453.1	2.87e-30	35	268	161	386
QBJ18653.1	2.87e-30	23	268	149	386
QIA07663.1	2.87e-30	23	268	149	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	1.19e-60	22	279	9	269	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
6RZN_A	3.02e-27	19	268	126	374	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_A	7.62e-19	43	192	135	281	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	7.69e-19	43	192	135	281	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
4RGY_A	7.96e-19	31	278	10	261	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	2.37e-19	23	278	429	668	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P10478	1.04e-16	22	276	48	274	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EY13	1.34e-16	23	187	498	662	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P9WM38	2.96e-14	35	179	184	319	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1
P9WM39	2.96e-14	35	179	184	319	Esterase Rv1288 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1288 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000208	0.999187	0.000175	0.000142	0.000135	0.000125

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000815_00377.