CAZyme Information: MGYG000000815_00499

Basic Information

• Species: Dysgonomonas capnocytophagoides
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas capnocytophagoides
• CAZyme ID: MGYG000000815_00499
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
741	MGYG000000815_1|CGC6	80190.63	6.1706

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000815	4510901	MAG	China	Asia

• Gene Location: Start: 627544; End: 629769 Strand: +

Full Sequence      

MKLKLIGIACLLSVAAGYAQQGNYEKEINALLSKMTLEEKIGQMNQLSYFETSDQLLTQI
KKGEIGSLLNIIDPVEVNKVQKAALENSRLGIPLIIGRDVIHGLKTVFPIPLGQAASFDP
QVVEAGARVAATESRELGINWTFAPMLDISRDARWGRIAESLGEDPYLAGQLGAAMVKGF
QGNDLSSPTSIAACVKHFIGYGAAEGGRDYNSTNIPPHLLHNVYLVPFKKAIDAGAATLM
TSFNDNDGIPASGNDYLLKDVLRKEWKFDGFVVSDWASMAEMIPHGYAKDGKDVARISAN
AGLDMEMVSGTYPKYLKELVQSGQVSIADIDNSVRNILRVKFRLGLFKNPYVDTSKASTI
YSQSHLEEARKAAVESAILLKNEGSLLPLKANLKVAVIGPLADAPHDQMGTWVFDGDKAH
TVTPLKALQTEFKNISYVYEPALSYSRDKSTANFEKAKQAAASADVAIVFLGEESILSGE
AHSLSNINLIGVQSDLLREVKSAGKPVVLVVMAGRPLTIERDLPYADAVLFNFHPGTMGG
PAIFDLIYGKANPSGKLPATFVREVGQIPMYYNHNNTGRPAPDGNVMTLDQIPVEAGQTS
LGNTSFYLDSGKNPLFPFGYGLSYSKFEYSGLALSSNSIPMGGMLTARVSIKNTSSVDGV
EVAQLYIRDLVGSIARPVKELKGFQRVALKAGESKTIEFTLTTDDLAFFGRDMQRKAEAG
DFKLWIGTSSAEGLETEFSIK

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	86	308	1.4e-73	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	1	738	2	762	beta-glucosidase BglX.
COG1472	BglX	2.75e-114	35	435	1	390	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	3.25e-97	36	340	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	2.91e-77	106	701	112	742	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.22e-56	377	624	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK53841.1	0.0	1	741	1	739
QIK59289.1	0.0	1	741	1	739
AFH08279.1	0.0	16	740	21	795
AIA99599.1	0.0	16	740	21	795
AIA99610.1	0.0	2	740	5	794

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	5.89e-199	25	741	11	752	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.33e-198	25	741	11	752	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	8.11e-194	25	741	10	751	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	1.69e-185	25	740	4	732	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	4.60e-185	16	740	22	764	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	1.98e-189	6	740	7	764	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	2.82e-186	6	740	7	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	9.17e-128	25	741	37	755	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	4.66e-125	25	727	36	762	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
T2KMH0	1.33e-115	25	736	34	717	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000920	0.998224	0.000315	0.000178	0.000173	0.000170

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000815_00499.