CAZyme Information: MGYG000000850_01078

Basic Information

• Species: CAG-521 sp900544345
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; CAG-521; CAG-521 sp900544345
• CAZyme ID: MGYG000000850_01078
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231		26511.63	9.0573

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000850	1767218	MAG	China	Asia

• Gene Location: Start: 109709; End: 110404 Strand: -

Full Sequence      

MRIRHLIKRLVALTLVLFLLVEGYYIAQVLWYSISPIETSAYIESEKERLGKVQFKPVLL
KNISSDMVKAAVAAEDVNFLEHFGIEWKATGEAFVSNVIEGERAPGGSTITQQTVKNLFL
THEKSYLRKFQEMLLSLVMEATWSKGRILQTYLNIAEFGEGIFGVEAAARHYYGVSARHL
THWQSVWLAAILSNPRYYEMHGSTDWLRHRIDVIEGSMKEPQFASINNRMR

Enzyme Prediction     

No EC number prediction in MGYG000000850_01078.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	54	218	1.3e-55	0.9265536723163842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	7.90e-77	4	218	2	223	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
pfam00912	Transgly	1.45e-65	49	219	7	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	7.23e-62	3	220	21	242	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02070	mono_pep_trsgly	1.95e-59	4	218	1	218	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
TIGR02074	PBP_1a_fam	2.65e-46	57	198	4	145	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ97963.1	6.00e-66	7	219	14	231
ANU66032.1	6.19e-66	7	219	15	232
QDQ86330.1	1.32e-51	3	219	4	234
AJD49758.1	9.64e-51	9	218	15	230
AWB35704.1	3.33e-50	2	222	3	229

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	2.39e-27	58	198	23	163	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	9.33e-27	58	198	23	163	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
4OON_A	9.60e-25	37	219	19	204	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5ZZK_A	3.17e-22	48	225	48	233	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	4.07e-22	48	225	12	197	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6T2A4	1.70e-48	3	214	4	221	Biosynthetic peptidoglycan transglycosylase OS=Janthinobacterium sp. (strain Marseille) OX=375286 GN=mtgA PE=3 SV=1
Q2KUU2	2.21e-48	15	219	21	235	Biosynthetic peptidoglycan transglycosylase OS=Bordetella avium (strain 197N) OX=360910 GN=mtgA PE=3 SV=1
A4G8N2	1.36e-47	3	214	4	221	Biosynthetic peptidoglycan transglycosylase OS=Herminiimonas arsenicoxydans OX=204773 GN=mtgA PE=3 SV=1
Q0AIQ0	2.78e-47	13	214	27	234	Biosynthetic peptidoglycan transglycosylase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=mtgA PE=3 SV=1
Q3SFZ8	7.89e-47	11	222	12	232	Biosynthetic peptidoglycan transglycosylase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999311	0.000455	0.000056	0.000002	0.000001	0.000217

TMHMM  Annotations     

start	end
12	34