CAZyme Information: MGYG000000872_01269

Basic Information

• Species: UBA7173 sp900540205
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp900540205
• CAZyme ID: MGYG000000872_01269
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607	MGYG000000872_13|CGC2	69009.48	5.0271

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000872	2772884	MAG	United States	North America

• Gene Location: Start: 53810; End: 55633 Strand: +

Full Sequence      

MKKIFVAVLSALFGIVNTPAAEWQVRTACAGDIKVVCQQPGDWKFELHVDSIDCKEILAV
VLTSDSLRQPPRFDVIISVPQLDIHHLWRPGDMDRCQLRPDWMGYYSSNLAFDMPLYAFI
NSNNGNRLTVAASEPLRNVDAQFGLVEEGSTLLGKLSYFNGPQTQMTRYETKIMLDPRPV
MWSEAIKEASEWMTAEAALEPVAAHEEAFAPLYSTWYNFHQNVTADRIERECLEASQMGM
KTIILDDGWQTDDNNRGYAFCGDWQVSPNRFPDFAAHVKRVQDMGMKYMVWYSVPYVGKK
SSNYERFKGKYLSESAEVGVLDPRFPEVREFLCSTYENAMKEYGLDGFKLDFIDSFRFDN
ADPAEADNYAGRDIKSLPAAIDVLMKEIYRRLSAIRPDVLIEFRQRYIGPAMRQYGNMFR
AGDCPADMQGNRQRIANLRLTSGESAVHSDMLEWNLAETPENAARHILSALFGVVQYSLM
LGELPENHTKVIRHWLDFSQKHRETLLKSEFRPYHPEKCYPVIEAESDDELIVAVYDDMS
VPEMKTSGKRTYIINASGAPSLVLDMPAGARRVVAYDVYGHEAAAPEIVKGVQRVAIPLS
GYLQIEY

Enzyme Prediction     

No EC number prediction in MGYG000000872_01269.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	185	542	4.3e-35	0.5334302325581395

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	4.21e-61	208	498	1	296	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	1.63e-16	211	352	3	151	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam02065	Melibiase	4.64e-16	212	508	44	346	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG1501	YicI	5.78e-09	219	451	269	509	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06591	GH31_xylosidase_XylS	1.53e-08	262	427	56	230	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46708.1	1.78e-176	56	607	33	587
QTH41069.1	1.35e-147	41	603	19	586
QOV11148.1	6.86e-146	33	606	9	586
QGQ97599.1	1.20e-144	53	601	31	583
QSF42796.1	7.19e-144	42	606	20	589

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YFN_A	9.89e-09	212	402	332	516	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5ARP5	5.98e-09	212	351	329	485	Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglG PE=2 SV=1
G4T4R7	6.00e-08	212	402	332	516	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000306	0.999082	0.000169	0.000144	0.000138	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000872_01269.