CAZyme Information: MGYG000000906_00781

Basic Information

• Species: Phocaeicola sp900552075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900552075
• CAZyme ID: MGYG000000906_00781
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	MGYG000000906_3|CGC4	38575.41	10.0556

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000906	2359165	MAG	China	Asia

• Gene Location: Start: 177897; End: 178928 Strand: +

Full Sequence      

MARILVIRFSALGDVAMTVPVLYSFARTFPQHQLVVLSRPNMAALFLEAPPNLFFLGVDV
KKEYTGIKGLFYLFLLLRREHFDFVADLHGVLRSRLLSFCFRISGVKVACIDKGRSQKRR
LISQKHKILVPQTTSFTRYAIVFQKLGFLFPLSFQSIYGKDKGNIEGVRQIVGYKSEKDR
WIGVAPFAAHKGKIYPITLQEEVVQALSQKENITLFLFGGGKEEIMQLEKWEQTYPHVIS
VAGKFKMSQELALMSHLDVMLAMDSGNMHLASLAGVPVVSIWGATHPYAGFMGWGQSEAN
AIQLSLPCRPCSIFGNKPCLRGDYACLNQITPRQIIQKVESLL

Enzyme Prediction     

No EC number prediction in MGYG000000906_00781.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	76	319	4.3e-34	0.9288888888888889

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	4.65e-48	3	340	1	276	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	1.30e-34	1	343	1	330	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	8.00e-16	82	311	13	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	1.81e-10	217	343	212	333	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	2.77e-10	3	285	7	291	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59711.1	6.12e-132	1	340	1	339
QUT74155.1	6.55e-132	1	343	1	343
QUT89241.1	8.68e-132	1	340	1	339
QQT78204.1	1.00e-130	1	343	1	342
ASM65268.1	1.00e-130	1	343	1	342

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57336	4.07e-08	6	287	13	286	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000906_00781.