CAZyme Information: MGYG000000924_00042

Basic Information

• Species: An172 sp002160515
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; An172; An172 sp002160515
• CAZyme ID: MGYG000000924_00042
• CAZy Family: GH136
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1323	MGYG000000924_1|CGC1	143205.07	4.1516

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000924	2081481	MAG	China	Asia

• Gene Location: Start: 47188; End: 51159 Strand: -

Full Sequence      

MKKKLLSVVLSVMLVLSAASMGISALAEELAAQPANNNVSAKASGEQEVETVEMDTLKYM
TLNPQGLVSNMADGFVAVTEQGNSGGVHLRTAKIGASITIDFNGSGFEFYGKKGSGAGDL
EISVDGGEAEVVSEYVSGNPEFEALLYEVDLGDTNEDHTIVITTKQGTVSNPNFNFDYFK
VIREKEEPPVVIEKVTEKVEMEDTSNKYMVLNPSELVGSEAEMTKGFVVANDPGNSGGKY
LRTSKIGATVTITFEGCGFEFYTKLGNGAGTLGVTVDGEPVEDISEYIDSSTPQFQQKLL
SLDFGNENKEHTIVFTTKETSKNNFNFDYFNIIRAEAVPGVIVSPGDTTYYLDSSAQDGG
DGKTEATAFESLEDINNIQFAPGDKILIKRGSTFIGQLYPKGSGSAEKPIIIDVYGEGDK
PLIDGNGLYSAVPSYGANGPFGESCSAVYLYNQEYWEINNLAVKNHTSAGDHTYELSGIR
VEASGGGIYNHIYIKNCEISDVNGRSQQDDIWTVRPQGGGTDFYGARTTHRTGGINIISY
TNRENNASDKTNPGTILDEEPTIFNDILIDGNVITNCDANGITTTNVKGELDDESYRHTN
VVISNNEISDVSRSGIITLYTSGVLVEHNVISEFQQYPDGWGCGAWCDRANNMVYQYNEV
KNGVDAYDGMAFNFDDMTHDGVIQYNYIHNNAGGSVMLHVRTNSYNRNNTVRYNVCVNDC
RDYNVNEAFIVCTGEDSVTQLENAQVYNNTFISSKVLYPVSRGKDIAFTNNIFCLTNPEM
ANKDGAYNAIGELTTFKNNIFAGYHPASEPKNTGNNSGNIYLGIEDVSKLFVNADKLTSV
QGTEAADKFDVANLAKLLPGSAAIDAGLEIDGRPSVDFAGNNVSGTADIGAFEYVSAVDK
TAVNEIYQTLKALNPDYYTEETYEAAAKAISELEAALMNDSLTEEDAKALAEKAENAYNA
LEEKAGDTEALKAKIKEAASYCEDNFKPDTFAALAEAVDNAQKALDSSEALTAKQVDELS
TAIDTAIAGLIKVGTPSIIQQDTMTASSPRSHAGNEAKYAIDGSTSSIWHTIWSSSEGQM
PVISENGRDNYITLDLGENKSVTRLTYLPRQDSSKNGDIAGYKIMYSTTADGDDFVEIAS
GTWANNKTVKVVDFDLVNARRIRLVATSTLGDTANTFISAAEINLYCTDYSALQEKTYEA
QKLYDDGTGIYTQESLQALKTAIDKANEVLGNADATQEKIDAAEIAVVKAVKGLEKIEDT
HITGDVYGDGKVGVEDVTLIQEYLVLLRDDINFEYADLNNDSKITVIDATIVQLIISGDY
NGQ

Enzyme Prediction     

No EC number prediction in MGYG000000924_00042.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH136	348	893	8.3e-102	0.9938900203665988
CBM32	1046	1183	4.3e-19	0.9274193548387096

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00754	F5_F8_type_C	6.88e-19	1043	1183	1	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	2.13e-12	1032	1168	2	130	Substituted updates: Jan 31, 2002
cd14256	Dockerin_I	9.33e-10	1264	1316	2	56	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam13229	Beta_helix	1.23e-08	565	717	9	140	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	1.52e-08	565	710	32	157	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYE35145.1	1.59e-120	346	880	34	583
AZG68471.1	7.44e-91	308	779	73	561
QNK55088.1	7.41e-50	348	886	58	530
QNK55089.1	3.13e-49	348	887	254	728
QJD84649.1	3.46e-47	347	887	254	727

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V6M_A	1.93e-26	348	893	9	576	ChainA, Fibronectin type III domain-containing protein [Tyzzerella nexilis]
2J7M_A	4.56e-22	1044	1186	13	148	Characterizationof a Family 32 CBM [Clostridium perfringens]
2J1A_A	4.69e-22	1044	1186	14	149	Structureof CBM32 from Clostridium perfringens beta-N- acetylhexosaminidase GH84C in complex with galactose [Clostridium perfringens ATCC 13124],2J1E_A High Resolution Crystal Structure of CBM32 from a N-acetyl-beta- hexosaminidase in complex with lacNAc [Clostridium perfringens ATCC 13124]
2V5D_A	3.46e-19	1044	1186	601	736	Structureof a Family 84 Glycoside Hydrolase and a Family 32 Carbohydrate-Binding Module in Tandem from Clostridium perfringens. [Clostridium perfringens]
4A41_A	4.96e-18	1028	1186	12	160	CpGH89CBM32-5,from Clostridium perfringens, in complex with galactose [Clostridium perfringens],4A44_A CpGH89CBM32-5, from Clostridium perfringens, in complex with the Tn Antigen [Clostridium perfringens],4A45_A CpGH89CBM32-5, from Clostridium perfringens, in complex with GalNAc- beta-1,3-galactose [Clostridium perfringens],4AAX_A CpGH89CBM32-5, from Clostridium perfringens, in complex with N- acetylgalactosamine [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0TR53	2.52e-18	1044	1186	631	766	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	2.52e-18	1044	1186	631	766	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
P29767	1.18e-12	1038	1186	50	184	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
I1S2N3	1.41e-11	1037	1194	48	196	Galactose oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GAOA PE=3 SV=1
P0CS93	1.86e-11	1037	1194	48	196	Galactose oxidase OS=Gibberella zeae OX=5518 GN=GAOA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000305	0.998963	0.000197	0.000200	0.000165	0.000145

TMHMM  Annotations     

start	end
5	27