CAZyme Information: MGYG000000963_00696

Basic Information

• Species: CAG-617 sp900553285
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-617; CAG-617 sp900553285
• CAZyme ID: MGYG000000963_00696
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
958		106838.57	4.8367

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000963	1599597	MAG	Denmark	Europe

• Gene Location: Start: 3580; End: 6456 Strand: +

Full Sequence      

MMAGGAMAFAMNMAAQDRPNIILFLVDDMGWQETSLPFWTEKTPLNERYRTPNMEKLAEV
GVKFTDAYACAISSPSRASLMSGMNAARHRVTNWTLNYGTKTDASNNVISLPDWNWNGIQ
PAATATPHDTVNSMLVTSLPQILHDHGYFTIHCGKAHYGAKTTSSSDPLTMGYDVNIAGS
AAGGPASYMPPYGNNTYPVPGLDEYASQNIFLTEALTQEAIKTVGNFLDENTDQQPFYLY
MSHYAIHAPYTEDARFSGNYKGVVDPQLGVQLSSGEVNHAALVEGMDKSLGDIRAFLEER
PEVAKNTIIIFMSDNGGQAISRQGRVNYDQNYPLRGGKGSSYMGGVREPMIVYWPGVTDQ
YAGTANDSRIMIEDFFPTIIEMAGITDYETVQHVDGRSFVDVLKGNIQGRDRTNIWNFPN
LWGESQSMNEGYGAYAAIMKGDYHLIYFWQTQERRLYNIKEDISEQNNLVGTHRDIANEL
SKELADSLRAYDAQRPSLKATGEPCPWPDDPSLVVETGTVLTLNDKIFKLSSENQKFYYR
IADNQKEDGTNRRTGYWMTGEHYGYDAIQVGMTSYSSGTSLERQLFYFMPGSDDTHFRIM
TYEGQNVGYVDGKTSADWNDGKPNDAATTVTVKYLQYGTPTSSEFQLRQSSVDGYYSIGV
GDEILNNRGTENGATANMKWVVNSNGETVSDAMKNRGSQYAFVAYDPNASVAVGEVATPH
NGIFMFSTDSTRNYYTIRDARSFYWTQGEHHGNPTIQINSNLLEGDEAEKQLYYFIPGSG
NRFYIYTYDEKPLIYTMGTTVDSWAEAKKPEDEQNTVESRYVQYGDVERGAFFQLIKSGN
GEAYGLRVNNELLNDRGSANGEAANMLWVVNTYKGINSNVTDQGSQYVFTYHSAGLPTAI
KPAAVTSTRPMSRAELTKLGDKVQVYDIRGIRVRNIQNAERGFYIVRTAADTYKVILN

Enzyme Prediction     

No EC number prediction in MGYG000000963_00696.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16144	ARS_like	1.07e-149	19	486	1	420	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16146	ARS_like	9.84e-68	19	484	1	401	uncharacterized arylsulfatase. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16145	ARS_like	8.21e-66	19	473	1	414	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16025	PAS_like	1.92e-63	17	469	1	402	Bacterial Arylsulfatase of Pseudomonas aeruginosa and related proteins. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16026	GALNS_like	2.14e-62	18	469	1	398	galactosamine-6-sulfatase; also known as N-acetylgalactosamine-6-sulfatase (GALNS). Lysosomal galactosamine-6-sulfatase removes sulfate groups from a terminal N-acetylgalactosamine-6-sulfate (or galactose-6-sulfate) in mucopolysaccharides such as keratan sulfate and chondroitin-6-sulfate. Defects in GALNS lead to accumulation of substrates, resulting in the development of the lysosomal storage disease mucopolysaccharidosis IV A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAR02039.1	9.38e-147	16	549	26	552
QUT89376.1	1.65e-142	12	509	17	498
ALJ59588.1	3.49e-141	12	509	17	498
AKJ65363.1	4.11e-60	2	504	9	460
QDT74124.1	9.40e-33	5	490	23	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6USS_A	6.50e-159	18	510	33	516	ChainA, Sulfatase [Bacteroides fragilis CAG:558],6USS_B Chain B, Sulfatase [Bacteroides fragilis CAG:558]
6UST_A	2.54e-53	18	503	4	469	ChainA, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi],6UST_B Chain B, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi],6UST_C Chain C, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi],6UST_D Chain D, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi]
7STT_A	8.20e-43	13	498	1	443	ChainA, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis],7STU_A Chain A, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis],7STV_A Chain A, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis]
6BIA_A	5.94e-33	12	497	20	450	Crystalstructure of Ps i-CgsB [Pseudoalteromonas fuliginea],6BIA_B Crystal structure of Ps i-CgsB [Pseudoalteromonas fuliginea],6BIA_C Crystal structure of Ps i-CgsB [Pseudoalteromonas fuliginea]
3ED4_A	1.12e-32	8	480	16	464	Crystalstructure of putative arylsulfatase from escherichia coli [Escherichia coli],3ED4_B Crystal structure of putative arylsulfatase from escherichia coli [Escherichia coli],3ED4_C Crystal structure of putative arylsulfatase from escherichia coli [Escherichia coli],3ED4_D Crystal structure of putative arylsulfatase from escherichia coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ9	1.59e-37	15	491	31	522	Sulfatase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22020 PE=3 SV=1
Q571E4	2.09e-26	15	424	24	409	N-acetylgalactosamine-6-sulfatase OS=Mus musculus OX=10090 GN=Galns PE=1 SV=2
P34059	2.84e-26	15	422	27	409	N-acetylgalactosamine-6-sulfatase OS=Homo sapiens OX=9606 GN=GALNS PE=1 SV=1
P25549	4.85e-26	18	446	85	476	Putative sulfatase AslA OS=Escherichia coli (strain K12) OX=83333 GN=aslA PE=3 SV=2
Q32KH5	2.86e-25	15	424	26	411	N-acetylgalactosamine-6-sulfatase OS=Canis lupus familiaris OX=9615 GN=GALNS PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.931133	0.068211	0.000295	0.000157	0.000073	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000963_00696.