CAZyme Information: MGYG000001247_02076

Basic Information

• Species: UMGS1370 sp900542035
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1370; UMGS1370 sp900542035
• CAZyme ID: MGYG000001247_02076
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	MGYG000001247_18|CGC3	43789.77	4.5296

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001247	2761406	MAG	Austria	Europe

• Gene Location: Start: 42275; End: 43405 Strand: +

Full Sequence      

MEILDRYIDQLLERSTPQAPIWNIEKIREGAKPSWNYMDGCMINAVLELYLIRKDPKYLE
FADSFIDYFVKEDGQILSYSPEDYNLDNVNAGKTLFDLYDLTGKEKYRKAMDTVYSQLET
QPRTSTGNFWHKKIYPNQIWLDGLYMAQPFYMQYEASYHDCKGCRDSYEQFLHVYDLMRD
CRNGLYYHAYDDSRQAFWCDKVTGLSDNFWLRALGWYAMALIDTMDVMPASMGQEQAELG
RIYKELIDAMLPYQDEETGMWYQVVNRGGISPNYLETSGSAIFAFAIMKSVRLGFLDDSY
YAYGKKAFDGICRTQLSEKDGELQLDGICLVAGLGNKEMREGTFDYYMREPIVKNEAKGV
APLILAYIEVMMREGR

Enzyme Prediction     

No EC number prediction in MGYG000001247_02076.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	29	371	1.1e-110	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	5.37e-84	32	369	31	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.94e-81	35	373	27	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG1331	YyaL	0.004	42	127	473	580	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX91776.1	3.42e-230	1	373	1	373
ANU47524.1	8.02e-229	1	373	1	373
QQR03578.1	8.02e-229	1	373	1	373
QRP36827.1	2.19e-226	1	373	1	373
ASN98361.1	2.19e-226	1	373	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.63e-100	35	369	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.20e-67	35	370	39	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	5.06e-67	35	370	29	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	3.16e-07	167	313	195	330	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.75e-06	167	314	196	332	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	6.58e-67	35	370	39	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	3.31e-42	146	372	1	230	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.31e-42	146	372	1	230	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001247_02076.