CAZyme Information: MGYG000001265_00115

Basic Information

• Species: Methylobacterium sp002778835
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Beijerinckiaceae; Methylobacterium; Methylobacterium sp002778835
• CAZyme ID: MGYG000001265_00115
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
725		78815.96	9.1934

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001265	4213059	MAG	Italy	Europe

• Gene Location: Start: 88804; End: 90981 Strand: +

Full Sequence      

MTQPRPRLPSPLAPWRGLRRGLRLLVSRLPGAAAARKGPFVGALDGLQGGVATGWAWDPL
RPGHPPTVEFLVDGRVLRRVRAELPREDVAAAGYGDGRAGFFAELPPDLFARGAVEVRAR
LAGSNWELSGSPRTERLGADWQRRLARGDRVRGAFRAWLARRLARAVAGRVLSLVVPVHD
TPPDWLRECLDSVLAQWCPAWELVCVDDASANPETRAVLADYAARDPRIRCLRNETNLGI
ARSVNRGIAAAAGTHIAFLDHDDALEPDAVFHLLRAAGPVRGLGAGLVYADEVLTGPDLS
QLIRPQLRPAWSWDYYLCHPYFVHPVCVEAGLARAVGGWDEGMDISGDVDFVLRVAERAE
RIAHVPAILYRWRTHESSTGHRMAERVEAATVVALDRHLARLSPGAKASATGLFNYYRAD
FPDPGGRVLAVIPTRDRLDLLRPCIESLRATARPDDLDILVVDHLSQDPATRAWLAAPPP
GVAVLRVEGPFNYAAINNAAVAHARARPGELPPFLLFANNDIEAREPGWLERMRALAGRP
EVGAVGATLLYPGGTVQHSGVLAGVNGPAEHAHKFVPFRDRSGARRPGPLGGLVATRDYS
AVTAACLMLRSEVFERVGGFDARFAVGFNDTDLCLRIREAGLSVLNDAQSVLLHRESATR
RAGDLKHPADTALFRERWAALLAEGDPFYSPLMGREGLDHQAARLGVNFPRARLRPGPSA
GRIVA

Enzyme Prediction     

No EC number prediction in MGYG000001265_00115.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	173	276	2e-27	0.6

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.47e-72	171	374	2	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	4.54e-38	431	656	2	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	4.07e-26	173	277	1	103	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1216	GT2	1.45e-24	430	690	7	255	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	5.58e-23	184	379	11	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTC87317.1	5.49e-203	42	724	139	794
QYF86454.1	2.58e-197	23	694	121	781
APH58236.1	3.88e-191	42	700	289	943
AHJ69599.1	5.47e-191	42	700	289	943
ABI63288.1	5.47e-191	42	700	289	943

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z86_A	2.09e-08	171	379	376	578	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	2.09e-08	171	379	375	577	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
6P61_A	3.62e-06	172	378	15	205	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	3.25e-87	153	699	345	894	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	7.68e-84	163	691	312	829	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P71057	8.19e-12	172	387	6	226	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
O32268	4.56e-10	171	268	7	102	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1
Q9CMP0	3.95e-09	171	379	434	636	Chondroitin synthase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=fcbD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001265_00115.