CAZyme Information: MGYG000001265_03697

Basic Information

• Species: Methylobacterium sp002778835
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Beijerinckiaceae; Methylobacterium; Methylobacterium sp002778835
• CAZyme ID: MGYG000001265_03697
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		36815.21	8.147

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001265	4213059	MAG	Italy	Europe

• Gene Location: Start: 26; End: 1027 Strand: +

Full Sequence      

MPALAYAPDGLAAAAGRIGIAYGSAAVHPMIERDPDYAAALARECGLLVCENATKMDAVL
PRPDLVSYAAADATLAFATRHRMRMRGHTLIWHEAIPAWVRPRIAGPGAETFLRQWITSA
AGHFRGRFESWDAVNEIVAPEEGRADGLRRSPWLAALGPRYVDLAFQMLAEVDPAAAGVW
NENDCEQAAPWMEARRALVLRTLEGLKRRGVPIRRLGLQGHLYSTFPLDQGKLRAFLREV
AGLGLAIEITELDVDDRAFPADPQKRDQGVADLGRRFLDTVLDEPAVLNVVTWNVTDRGT
WLNASPIRRRPDGLPQRALPLDAQYRRKPLCRP

Enzyme Prediction     

No EC number prediction in MGYG000001265_03697.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	20	330	1.5e-64	0.9372937293729373

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	3.52e-66	22	329	12	303	Glycosyl hydrolase family 10.
COG3693	XynA	2.08e-59	34	330	47	333	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
smart00633	Glyco_10	5.34e-55	55	329	2	258	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ92216.1	2.22e-131	9	330	42	368
ACB25881.1	2.22e-131	6	330	39	368
AWV16121.1	2.22e-131	9	330	42	368
APT32678.1	1.80e-130	9	330	42	368
AWN41119.1	1.99e-130	6	330	44	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XYZ_A	7.63e-41	19	329	36	335	ChainA, 1,4-BETA-D-XYLAN-XYLANOHYDROLASE [Acetivibrio thermocellus],1XYZ_B Chain B, 1,4-BETA-D-XYLAN-XYLANOHYDROLASE [Acetivibrio thermocellus]
6FHE_A	2.78e-37	26	329	26	333	Highlyactive enzymes by automated modular backbone assembly and sequence design [synthetic construct]
3NIY_A	5.65e-37	15	302	26	306	Crystalstructure of native xylanase 10B from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3NIY_B Crystal structure of native xylanase 10B from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3NJ3_A Crystal structure of xylanase 10B from Thermotoga petrophila RKU-1 in complex with xylobiose [Thermotoga petrophila RKU-1],3NJ3_B Crystal structure of xylanase 10B from Thermotoga petrophila RKU-1 in complex with xylobiose [Thermotoga petrophila RKU-1]
6WQW_A	6.81e-37	33	332	23	324	ChainA, Beta-xylanase [Thermobacillus composti]
1V6Y_A	2.92e-36	11	329	5	305	CrystalStructure Of chimeric Xylanase between Streptomyces Olivaceoviridis E-86 FXYN and Cellulomonas fimi Cex [Streptomyces olivaceoviridis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	6.01e-38	19	329	526	825	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
Q12603	3.76e-37	41	312	61	331	Beta-1,4-xylanase OS=Dictyoglomus thermophilum OX=14 GN=xynA PE=3 SV=1
Q60041	7.20e-32	43	302	59	309	Endo-1,4-beta-xylanase B OS=Thermotoga neapolitana OX=2337 GN=xynB PE=3 SV=1
P36917	2.82e-31	26	303	371	651	Endo-1,4-beta-xylanase A OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynA PE=1 SV=1
O69231	7.75e-31	25	310	20	308	Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis OX=198119 GN=xynB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999957	0.000098	0.000003	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001265_03697.