CAZyme Information: MGYG000001273_01898

Basic Information

• Species: Pauljensenia sp902373435
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia sp902373435
• CAZyme ID: MGYG000001273_01898
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
787		84772.24	5.0899

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001273	2113963	MAG	Italy	Europe

• Gene Location: Start: 134; End: 2497 Strand: -

Full Sequence      

MTLRRYGRALAAVSGAALMCASFSVPALATPESDTQPGDAATASASEATPAPITVTATRT
DKLGDKVYVGDTLTYTFTYTNQTDAALTVFPKESNLSGVLTTGAPNCRWHNLSAHTTKQC
TSATHTVTEADLAAGSFTPTSAWAATRDRNGNDVIAGGISANAEAVTVLPGSRTHEPDPV
ETPKDYAIGEVARLASPGVAGFKCHRIPALTTAANGWIIAAWDGRPETCQDAPQANSIVY
RISKDGGKSWTPIQTALAGTPGANKVGFSDPSFVVDRSTGTIFLFSVKSFDAGLFQSQLG
TDPNARNILHAHVVESHDNGQTWVNPRTITDQVTQGHDDQWFTRFASSGEGIQLRYGAHA
GRLIQQYAVANSGSTSLMAVSVYSDDHGATWKPGAPSEGSADENKVVELSDGRLLLNSRT
QGTAGQRLEAISYDGGQTWGPFRHNWDLTDPRNNASIIRAYPNAPQGSARARVLLFSNAD
SSSARANGTIRVSYDDGFTWNEGKVFESGDMAYSTLHALNDGTWGLLYETGGYKNIDFMR
VDAAYLGLSDPGEDVAPTPQPTPSVDPQPAPTPTPSVDPTPAPTAEPTPSVDPSPSPSVD
PTPAPQPTPDPEPTPAPDPKPSAAPAHWVNTADGWKWQLEDGSFAASQSVVIGDATYRFN
ADGIMVTGWDQQDGKWSHYTSYGARTNGWFEEAGHWYYFDPSTGVMKIWWAQIDGHWYNF
GLDGRMVTGWKNLDGHWYRFGTDGHMATGWQRIGLSWYYFGNDGQMRTGWQKIDGRWYYF
ARSGAWI

Enzyme Prediction     

EC	3.2.1.18	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	191	540	7.7e-88	0.9736842105263158

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	2.64e-95	194	542	3	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
NF033930	pneumo_PspA	5.11e-47	542	785	348	580	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	1.50e-43	553	785	414	643	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
COG4409	NanH	1.63e-39	194	509	264	615	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
NF033840	PspC_relate_1	1.78e-29	667	784	510	627	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT36491.1	0.0	1	685	1	651
QGS10752.1	0.0	1	682	1	636
QQC44728.1	0.0	1	679	1	620
AKU65858.1	0.0	1	679	1	620
AOZ72269.1	9.39e-177	53	566	41	556

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EUR_A	6.60e-117	178	547	6	360	Sialidase[Micromonospora viridifaciens],1EUS_A Sialidase Complexed With 2-Deoxy-2,3-Dehydro-N- Acetylneuraminic Acid [Micromonospora viridifaciens]
1EUT_A	1.12e-113	178	547	6	360	Sialidase,Large 68kd Form, Complexed With Galactose [Micromonospora viridifaciens],1EUU_A Sialidase Or Neuraminidase, Large 68kd Form [Micromonospora viridifaciens]
1WCQ_A	3.88e-113	178	547	2	356	Mutagenesisof the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_B Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_C Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens]
2BZD_A	7.65e-113	178	547	2	356	Galactoserecognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_B Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_C Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens]
1W8N_A	1.07e-112	178	547	2	356	Contributionof the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens. [Micromonospora viridifaciens],1W8O_A Contribution of the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens [Micromonospora viridifaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02834	5.10e-113	155	547	29	402	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
P31206	1.75e-28	206	530	204	527	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
P29767	1.44e-24	190	546	380	826	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
Q4WQS0	7.85e-19	166	534	13	368	Exo-alpha-sialidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_4G13800 PE=1 SV=2
O35657	1.48e-17	199	531	65	390	Sialidase-1 OS=Mus musculus OX=10090 GN=Neu1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000720	0.896032	0.100293	0.002365	0.000348	0.000216

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001273_01898.