CAZyme Information: MGYG000001308_01194

Basic Information

• Species: Streptococcus infantarius
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus infantarius
• CAZyme ID: MGYG000001308_01194
• CAZy Family: CBM61
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
221	MGYG000001308_6|CGC1	25094.65	4.4938

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001308	1925087	Isolate	not provided	not provided

• Gene Location: Start: 33864; End: 34529 Strand: -

Full Sequence      

MTDLVDEIKDVKNNNGLGFFYWEPLWYNGNVSWATQAGMSYLGVSDVTGNEWENQAVFDF
QGNALRGIRAFNYSNLTNLLQNNSFEWDSYTESPSSWNVWKNGQISGIKTEVYDNTRYKL
SFWSDKAYESSIYQTVGNLSSGTYKLSIDAMGGTSLENAELYIKNYGGNEQKISLKDSNT
WKTYTIDNIQITNGQCEVGAYVKSSANKWLNIDNVRLVKVN

Enzyme Prediction     

No EC number prediction in MGYG000001308_01194.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM61	78	217	8.9e-38	0.9858156028368794

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3867	GanB	1.44e-14	3	73	321	393	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
pfam07745	Glyco_hydro_53	1.76e-09	1	71	274	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQG55563.1	6.90e-155	1	221	41	261
VTT08063.1	6.90e-155	1	221	41	261
QMS96597.1	3.24e-153	1	221	316	536
QGX44116.1	3.24e-153	1	221	316	536
QGX46320.1	4.60e-153	1	221	316	536

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X7O_A	6.47e-13	78	219	1110	1261	Crystalstructure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase [Paenibacillus sp. 598K],5X7O_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase [Paenibacillus sp. 598K],5X7P_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with acarbose [Paenibacillus sp. 598K],5X7P_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with acarbose [Paenibacillus sp. 598K],5X7Q_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with maltohexaose [Paenibacillus sp. 598K],5X7Q_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with maltohexaose [Paenibacillus sp. 598K],5X7R_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with isomaltohexaose [Paenibacillus sp. 598K],5X7R_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase complexed with isomaltohexaose [Paenibacillus sp. 598K],5X7S_A Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase, terbium derivative [Paenibacillus sp. 598K],5X7S_B Crystal structure of Paenibacillus sp. 598K alpha-1,6-glucosyltransferase, terbium derivative [Paenibacillus sp. 598K]
7OSK_A	9.10e-06	1	71	331	391	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001308_01194.