CAZyme Information: MGYG000001333.1_00849

Basic Information

• Species: Lentilactobacillus hilgardii
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lentilactobacillus; Lentilactobacillus hilgardii
• CAZyme ID: MGYG000001333.1_00849
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
274		29860.57	9.7439

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001333.1	3077266	Isolate	not provided	not provided

• Gene Location: Start: 588499; End: 589323 Strand: -

Full Sequence      

MAKGAVCLLVAAGFLFFNGHSAGASVSSDFINRLKVPVQKVSRENHLYPSVMMAQAIVES
DFGRSTLSTEANNYFGIKGTYNGQSVTMSTGEYTSKGKHYMTAAQFKKYPSIVASIRDNA
SLLRHGTLVDPNYYSGTWTTNAVTASDAAMALATTYATDMNYGNKLNAIIVKYHLDELDA
HNGDSTIGTAGNINEQIEQSLKKELGTSASTRQSGRTNQTGQVRSKITSIPERIIPRSVF
EPRKAQSSADNEYTLQLNLSLEKIIKNGNTKRIH

Enzyme Prediction     

No EC number prediction in MGYG000001333.1_00849.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	38	175	1.9e-29	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.52e-46	30	194	46	201	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK06347	PRK06347	2.86e-40	22	192	146	314	1,4-beta-N-acetylmuramoylhydrolase.
PRK08581	PRK08581	1.62e-38	29	179	322	472	amidase domain-containing protein.
smart00047	LYZ2	3.47e-26	29	173	10	139	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	7.91e-23	39	118	5	76	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHB52309.1	1.06e-191	1	274	1	274
QEU38810.1	3.54e-190	1	274	1	274
QIR09716.1	3.54e-190	1	274	1	274
QGV25979.1	3.66e-100	1	266	1	257
AFS00453.1	7.61e-100	1	266	1	258

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	3.95e-37	30	179	33	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	2.88e-26	30	179	63	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	2.00e-30	28	225	181	367	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
A2RHZ5	2.29e-27	22	194	57	223	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
Q9CIT4	3.23e-27	22	190	57	222	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P39046	5.32e-27	30	191	65	231	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
P0C2T5	6.01e-27	22	194	57	223	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000234	0.999175	0.000144	0.000144	0.000129	0.000122

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001333.1_00849.