CAZyme Information: MGYG000001333.1_01363

Basic Information

• Species: Lentilactobacillus hilgardii
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lentilactobacillus; Lentilactobacillus hilgardii
• CAZyme ID: MGYG000001333.1_01363
• CAZy Family: GH2
• CAZyme Description: Beta-glucuronidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
617	MGYG000001333.1_104|CGC4	70611.38	4.8933

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001333.1	3077266	Isolate	not provided	not provided

• Gene Location: Start: 390703; End: 392556 Strand: +

Full Sequence      

MLYPMTTPSRALIDLSGLWKFMIDKEVQPIDPKQPLPTEDVISVPASFNDQTASQEIREH
VGYVWYETNFSIARALRSERLVLRFGSATHEAWVYLNGQEITHHKGGFTPFEVVINDYLN
DGNNRLTVKLSNVLDYSTLPVGNYSESTDEDGHVVRHLDENFDFFNYAGLQRPVKIYSTP
KDYIQDITIVPNVDLDRSSAEIEIKTQISDGLDKVKVTILDQDGHPVAEVSGTDSSVTLT
DVRLWQPLNAYLYSAQVDGFKNGELVDSYSEAFGIRKIEVRDGQFLFNGQPFYFKGFGKH
EDTYVHGRGFNEPVNVLDINLMKDMGANSFRTSHYPYSEEMMRLCDREGIVVIDETPAVG
LMASFDFNLSILEQDDFEDDTWKTMKTAAAHQQVIQEIIDRDKNHACVAMWSIANEAATF
SKGAHEYFKPLFDLARRLDPQKRPCTYTSIMMANPRTDKCIDLVDVIALNRYYGWYVGNG
DLKTAEKATRDELLEYQAKFPEKPIIYTEYGADTVAGLHSNYGEPFSEEFQEDYYRMASK
VFDEIPNFVGEQLWNFADFQTKFGIQRVQGNKKGIFTRSREPKMVVRYLKNRWTAIPNLG
YKVKSDTQDQAKKLTTK

Enzyme Prediction     

EC	3.2.1.31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	7	587	2.4e-104	0.6063829787234043

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	0.0	1	604	1	603	beta-D-glucuronidase; Provisional
COG3250	LacZ	1.04e-109	1	594	1	596	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	1.43e-83	278	598	1	302	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	1.47e-41	66	571	113	556	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	1.63e-34	7	416	47	462	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHB52750.1	0.0	1	617	1	617
QGV25192.1	0.0	1	604	1	604
QUX06201.1	0.0	1	602	1	602
AEB74096.1	0.0	1	602	1	602
AFS00923.1	0.0	1	602	1	602

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4JKM_A	1.29e-242	1	602	4	601	CrystalStructure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],4JKM_B Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],6CXS_A Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13],6CXS_B Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13]
4JKK_A	2.46e-235	1	605	4	600	CrystalStructure of Streptococcus agalactiae beta-glucuronidase in space group I222 [Streptococcus agalactiae 2603V/R],4JKL_A Crystal Structure of Streptococcus agalactiae beta-glucuronidase in space group P21212 [Streptococcus agalactiae 2603V/R],4JKL_B Crystal Structure of Streptococcus agalactiae beta-glucuronidase in space group P21212 [Streptococcus agalactiae 2603V/R]
6D4O_A	6.81e-208	1	604	4	614	Eubacteriumeligens beta-glucuronidase bound to an amoxapine-glucuronide conjugate [Lachnospira eligens]
6BO6_A	7.04e-207	1	604	1	611	Eubacteriumeligens beta-glucuronidase bound to UNC4917 glucuronic acid conjugate [[Eubacterium] eligens ATCC 27750]
6BJW_A	1.59e-206	1	604	25	635	ChainA, Glycoside Hydrolase Family 2 candidate b-glucuronidase [[Eubacterium] eligens ATCC 27750]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P05804	3.44e-165	1	602	1	596	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
O18835	6.38e-137	1	598	27	630	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1
O97524	5.04e-136	1	598	27	630	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1
P08236	6.24e-134	1	598	27	631	Beta-glucuronidase OS=Homo sapiens OX=9606 GN=GUSB PE=1 SV=2
P06760	8.06e-134	1	598	27	627	Beta-glucuronidase OS=Rattus norvegicus OX=10116 GN=Gusb PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001333.1_01363.