CAZyme Information: MGYG000001378_04930

Basic Information

• Species: Bacteroides ovatus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ovatus
• CAZyme ID: MGYG000001378_04930
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
621	MGYG000001378_15|CGC1	71401.61	8.1931

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001378	6545242	Isolate	not provided	not provided

• Gene Location: Start: 18580; End: 20445 Strand: +

Full Sequence      

MNYKKWIIGLCILNILPALSQEYNIENIHIDGYIGNRINTCIEHRVKSQNTDHLIEPFKH
RNEDHLWQSEFFGKWLLGAIASYQYTKDKELYNLITNSVEKLMNTQTSDGYIGNYKREAQ
LTNWDIWGRKYTSLSLLSYYRLTGDKKALNAVERLINHLMEQLQIHNINIAATGYYLGMA
SCSILEPVVYLYDITRNPRYLSFAKSIVSSIEREGSSQLITKTLRNIPVSERSAFPKSWW
SFENGQKAYEMMSCYEGLIELGTIVNDPFYIRIAEKAVNNIQEDEINIAGSGAAFECWYK
GKEKQTLPTYHTMETCVTFTYMQLCHRLLCKTGNSFYAEEFEHTMYNALMATMKNDGSQI
SKYSPLEGRRQPGEEQCGMHINCCNANGPRGFALIPKTACTIKDNHIYLNLYLPLQATIS
LNKKNKVHLNVESDYPIHGKVNVNIGVQKKEKFTLALRIPTQIEKMKAYINGEEQEITHK
GGYLYIERIWENADKVTLDFKIETKVVKLNNSQAIVRGPLLFARDSRFNDGDIDECATIK
CNNQGVIQAKIKKNKTGTFPWITLTVPAVLGTDLENVENKTPKLINFCDFSSSGNDWNPN
GRYRVWIPQTFHAMSEPYKKY

Enzyme Prediction     

No EC number prediction in MGYG000001378_04930.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	46	522	1.6e-57	0.9389312977099237

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	9.19e-58	62	523	50	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.57e-45	53	523	49	501	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04792	LanM-like	2.97e-04	133	214	500	581	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
cd04792	LanM-like	7.80e-04	71	283	545	744	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
COG4403	LcnDR2	0.006	69	228	700	841	Lantibiotic modifying enzyme [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	1.54e-296	1	621	1	620
BCZ47937.1	1.21e-36	66	533	72	569
AVK51332.1	4.00e-36	66	533	72	569
AQS05105.1	1.33e-35	66	533	72	569
AIU03254.1	3.25e-35	66	533	72	569

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	3.99e-28	74	529	74	554	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	1.12e-22	41	522	41	559	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	2.10e-21	18	526	34	610	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QK0_A	1.80e-20	41	522	41	559	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000196	0.999191	0.000156	0.000150	0.000146	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001378_04930.