CAZyme Information: MGYG000001388_03184

Basic Information

• Species: Desulfitobacterium hafniense
• Lineage: Bacteria; Firmicutes_B; Desulfitobacteriia; Desulfitobacteriales; Desulfitobacteriaceae; Desulfitobacterium; Desulfitobacterium hafniense
• CAZyme ID: MGYG000001388_03184
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	MGYG000001388_51|CGC1	36517.26	4.3363

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001388	5194328	Isolate	not provided	not provided

• Gene Location: Start: 220315; End: 221346 Strand: -

Full Sequence      

MKITKAISSTLLVTLFMFTAIPSAVFGVPADKYSYSLTGKVGTETATLQFEPSPAEEYEV
VLVEADAEVKFTPKEKMSATIRAYDPEGFYAGSLMWTIDGQEEAVTEIEANKTATAILTE
YFWGMEPYYVLSFGNDGDTTKIVYKISDGTATPAPETTPAPTEEPAPAPTPEPAPAPTPE
PAPAPTLEPAPAPTPEPAPVPTPEPTPAPAPAPAPTPAPVAESQGNVTYAVQAGDTLGTI
ALNHYGSYEYHTKIYNANKELLKKNNNNLTVGMSLVLPGDGLLPALKSESGTIYTVQAGD
TLGKIAAKHYGDASKYMSIYEANKDRIKNPNLIFEGQKIVLTK

Enzyme Prediction     

No EC number prediction in MGYG000001388_03184.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11198	PRK11198	1.33e-17	280	343	84	147	LysM domain/BON superfamily protein; Provisional
cd00118	LysM	3.94e-10	292	341	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
COG1652	XkdP	2.79e-09	294	341	213	261	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
smart00257	LysM	8.95e-09	293	341	1	44	Lysin motif.
NF033163	lipo_LipL71	3.72e-07	294	341	407	459	lipoprotein LipL71. Members of this family are lipoprotein LipL71, also known as LruA, as described in Leptospira interrogans but found broadly in the genus Leptospira. Close homologs that are not lipoproteins by sequence are likely defective in their reported coding region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDX00994.1	2.18e-191	1	343	1	343
BAE82858.1	8.97e-191	1	343	11	353
AFM00140.1	1.72e-171	1	343	1	321
AEY67170.1	2.80e-117	1	343	1	319
AFM00200.1	3.62e-37	221	341	420	541

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FIM_A	1.54e-07	280	337	85	142	Thestructure of Kbp.K from E. coli [Escherichia coli],7PVC_A Chain A, Potassium binding protein Kbp [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WM38	1.67e-07	229	341	56	152	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1
P9WM39	1.67e-07	229	341	56	152	Esterase Rv1288 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1288 PE=1 SV=1
P0ADE6	7.35e-07	280	337	85	142	Potassium binding protein Kbp OS=Escherichia coli (strain K12) OX=83333 GN=kbp PE=1 SV=2
P0ADE7	7.35e-07	280	337	85	142	Potassium binding protein Kbp OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=kbp PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000400	0.998834	0.000216	0.000185	0.000174	0.000171

TMHMM  Annotations     

start	end
7	29