CAZyme Information: MGYG000001393_04022

Basic Information

• Species: Hafnia paralvei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Hafnia; Hafnia paralvei
• CAZyme ID: MGYG000001393_04022
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
204	MGYG000001393_74|CGC1	22641.76	6.5971

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001393	4880992	Isolate	not provided	not provided

• Gene Location: Start: 46651; End: 47265 Strand: -

Full Sequence      

MFTMISLPKQPARLAIIVCMLFLAGCTHKHSYKKHDAHAYDDVIEDAADDYKVDPKLIAA
IIQVESSFNPEAVSPSNAIGLMQIKASTGGCDAYRYKGKSGCPDDDDLLDPETNIDLGAA
YIGAIQYQQLNWIDDPVTRRYATEVAYANGAGALLRTFSSNRKTAIKMINQLSPEAFHWH
VRQYHPAAQAPKYMAKVEQVYNTL

Enzyme Prediction     

No EC number prediction in MGYG000001393_04022.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	52	202	1.6e-22	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	5.92e-71	44	202	3	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK15470	emtA	4.07e-61	20	204	10	203	membrane-bound lytic murein transglycosylase EmtA.
PRK11671	mltC	2.58e-50	37	197	189	349	membrane-bound lytic murein transglycosylase MltC.
pfam01464	SLT	8.28e-24	47	167	4	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	8.90e-22	37	200	136	294	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQE45854.1	1.60e-146	4	204	1	201
AJQ98290.1	1.32e-145	4	204	1	201
AMH19947.1	1.48e-142	4	204	1	201
AMO81587.1	8.11e-131	4	204	1	201
QIP55096.1	1.15e-130	4	204	1	201

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8P_A	3.34e-49	53	204	35	186	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	4.38e-49	53	204	52	203	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
6GHY_A	9.49e-49	53	204	35	186	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	9.49e-49	53	204	35	186	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]
6GI4_B	9.49e-49	53	204	35	186	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7MKC3	1.75e-53	20	204	10	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=emtA PE=3 SV=2
B7UQ77	8.05e-52	20	204	10	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) OX=574521 GN=emtA PE=3 SV=1
A1AAB6	1.14e-51	20	204	10	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli O1:K1 / APEC OX=405955 GN=emtA PE=3 SV=2
B7MK90	1.14e-51	20	204	10	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli O45:K1 (strain S88 / ExPEC) OX=585035 GN=emtA PE=3 SV=1
B7NUV4	1.14e-51	20	204	10	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) OX=585057 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000030	0.999999	0.000001	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001393_04022.