CAZyme Information: MGYG000001400_02389

Basic Information

• Species: Erysipelatoclostridium ramosum
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Erysipelatoclostridium; Erysipelatoclostridium ramosum
• CAZyme ID: MGYG000001400_02389
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489	MGYG000001400_2|CGC15	56252.72	5.0852

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001400	3785853	Isolate	not provided	not provided

• Gene Location: Start: 754315; End: 755784 Strand: -

Full Sequence      

MRKFPEGFLWGGATAANQVEGGWKEGGKGISVSDCARHHLDVDVENYKAHNHITSKDIEE
ALASDDDSLYPKRHGSQFYYHYKEDIKMFAEMGFKVYRMSIAWSRIFPNGDDEQPNEAGL
KFYDDVFDECAKYGIEPLVTMSHYEPPLNLVLKYNGWYNRKLVGFFETFVKTICERYKNK
VKYWLTFNEVDSMIRHPYTTGGLIEDRFPGIKWNQVIFQAMHHQFVASALATKICHEIIS
DSMVGCMLTKLTYYPYSCKPEDVLQAQQDMRGTYCYSDTQVFGEYPAYLLAKFKNEGVEI
VKEPGDDEVMKKYPVDFVSFSYYMSSCSAASSEGLDTAVGNTVTAVKNPYLPSSEWGWQI
DPIGLRISMVDLYDRYRKPLFIVENGLGAKDVVLPDGTIDDQYRIDYFDCHFKEMLNAIE
IDGVECLGYTSWGCIDIVSESTKQMSKRYGFIYVDADDYGKGTYKRIPKKSFYWYKKVIE
TNGACLFED

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	483	1.5e-139	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	486	1	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	1	486	1	473	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	1	483	1	454	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	4	486	6	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	4.78e-175	3	486	5	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY27848.1	0.0	1	489	1	489
QQV07750.1	0.0	1	489	1	489
QPS14550.1	0.0	1	489	1	489
QMW73411.1	0.0	1	489	1	489
QLY82156.1	0.0	2	487	4	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	3.78e-188	2	486	6	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	2.52e-171	5	486	9	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4IPL_A	6.67e-171	1	488	17	487	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
4F66_A	1.83e-166	1	483	4	477	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	5.21e-166	1	483	4	477	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	2.39e-186	2	486	6	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	1.16e-180	1	486	1	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	6.41e-180	3	486	6	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q48409	8.26e-171	1	488	1	464	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
Q46829	1.38e-170	5	486	9	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001400_02389.