CAZyme Information: MGYG000001406.1_01677

Basic Information

• Species: Kurthia massiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_A; Planococcaceae; Kurthia; Kurthia massiliensis
• CAZyme ID: MGYG000001406.1_01677
• CAZy Family: CBM50
• CAZyme Description: putative peptidoglycan endopeptidase LytE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
248		25678.65	10.1366

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001406.1	3201180	Isolate	not provided	not provided

• Gene Location: Start: 241980; End: 242726 Strand: -

Full Sequence      

MNTTTKIFSSLALTTMLFSATAGSASAMANDGGQGQAPKQTSVSKSTNTYTVQRGDTLSS
IASKYGTSYQQLMSINGLSSITIYAGQSLKVSGSAKVTKTAAPTTQASTTPQYKRSTSTS
STTTTTSSSASYSSVAQAALAQVGVPYKWGGKTPAGFDCSGLVYYAMQKAGKSVGYATSA
GYYSMGTSVSTPQVGDLVFFQNTYKSGISHVGIYIGNGQMVSAASGGVQIDAVQGAYWKN
HFVGYKRF

Enzyme Prediction     

No EC number prediction in MGYG000001406.1_01677.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	50	91	6e-16	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00877	NLPC_P60	5.54e-35	144	247	1	105	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
PRK13914	PRK13914	9.61e-30	43	247	195	480	invasion associated endopeptidase.
COG0791	Spr	1.10e-26	135	246	78	197	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
pfam01476	LysM	4.79e-17	50	91	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd00118	LysM	2.33e-14	49	91	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQQ53340.1	4.24e-58	49	247	29	207
AQQ53462.1	3.42e-57	49	247	29	207
VEI06643.1	7.55e-57	40	248	134	343
AMA63420.1	8.16e-56	49	248	149	355
AQQ55302.1	5.70e-54	50	247	30	211

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7CFL_A	3.96e-16	134	247	16	136	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
4XCM_A	3.94e-14	49	247	4	229	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]
6B8C_A	7.08e-12	133	234	29	132	Crystalstructure of NlpC/p60 domain of peptidoglycan hydrolase SagA [Enterococcus faecium]
3NE0_A	1.11e-11	135	230	88	194	Structureand functional regulation of RipA, a mycobacterial enzyme essential for daughter cell separation [Mycobacterium tuberculosis H37Rv]
3PBC_A	1.11e-11	135	230	88	194	ChainA, Invasion Protein [Mycobacterium tuberculosis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54421	8.58e-44	49	248	150	334	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1
O07532	1.85e-37	49	248	308	487	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2
O31852	6.76e-33	38	248	216	413	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
Q01835	1.97e-26	49	247	298	510	Probable endopeptidase p60 OS=Listeria grayi OX=1641 GN=iap PE=3 SV=1
Q01837	9.11e-25	50	247	314	523	Probable endopeptidase p60 OS=Listeria ivanovii OX=1638 GN=iap PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000295	0.998917	0.000205	0.000205	0.000174	0.000155

TMHMM  Annotations     

start	end
7	29