CAZyme Information: MGYG000001408_02021

Basic Information

• Species: Brevibacterium senegalense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Brevibacteriaceae; Brevibacterium; Brevibacterium senegalense
• CAZyme ID: MGYG000001408_02021
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	MGYG000001408_5|CGC3	52858.95	6.3753

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001408	3398887	Isolate	not provided	not provided

• Gene Location: Start: 195819; End: 197270 Strand: +

Full Sequence      

MSEKKPVVARVIGIGVVGVAAMGGLLMWLAVVFSDPASPGAREAVLFGSWRVLYDDYTPP
VAVLVIALITAAVFVVIAVVAEQVVTSRSRRSDDAEGLPLAPKIVMAQTRGVYHGPITVT
VLIPAHNEEERISSTIEALQAQDDGPDRIIVVADNCTDATPDLARAAGVEVFETRDNADK
KAGGLNQALRGLLPHAGENDIVMIVDADTALDQGFVTEARRRFTVDRALMAVGGLFYGED
GAGLIGQFQRNEYTRYGRDIRRRRGRVFVLTGTASAFRARGLRTVAESRGTLIPGRTGDV
YDTAALTEDNELTLALKSLGGLMVSPDECSVVTEVMPTWKQLWHQRLRWQRGALENLGAY
GVTPQTIRYWFQQLGIGYGAVALGSYFLVIILTLLARDEWVWYPFWMILGAIFMIERVVT
VWRSTWGARIVAALLIPELVFAAFLNIVFLKGALEILLGRKATWGRSDAVPVHANENEER
GRP

Enzyme Prediction     

No EC number prediction in MGYG000001408_02021.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	118	352	1.3e-21	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	1.61e-39	115	466	52	405	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	3.20e-34	121	309	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06438	EpsO_like	4.42e-28	121	223	1	106	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd00761	Glyco_tranf_GTA_type	4.00e-17	121	234	1	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06439	CESA_like_1	1.49e-16	118	224	30	135	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGS34418.1	7.13e-264	1	471	1	471
ASJ19095.1	1.07e-256	1	480	1	488
AMJ44960.1	1.07e-256	1	480	1	488
AQX71411.1	1.07e-256	1	480	1	488
BAF54100.1	1.07e-256	1	480	1	488

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	5.74e-08	119	352	51	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
P75905	3.27e-07	118	355	76	302	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
Q8XAR5	3.27e-07	118	355	76	302	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 OX=83334 GN=pgaC PE=3 SV=1
Q2YWE6	6.21e-06	118	208	40	128	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=crtQ PE=3 SV=1
Q6GDN6	8.24e-06	120	219	42	139	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=crtQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
59	81
374	396
400	419
426	448