CAZyme Information: MGYG000001421_01727

Basic Information

• Species: Dielma fastidiosa
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Dielma; Dielma fastidiosa
• CAZyme ID: MGYG000001421_01727
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
194	MGYG000001421_4|CGC3	22371.95	4.3452

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001421	3575388	Isolate	not provided	not provided

• Gene Location: Start: 255129; End: 255713 Strand: -

Full Sequence      

MWDEHNVHLDITDQDLIDLQEGKVDLYTFSYYMSTVVTSHEVKETVSGNFSAGAKNPYLT
YSDWGWALDPKGLRYYLEMIYDRYELPLMVVENGLGAYDEVESDGAIHDPYRIDYIREHI
LDMDKAIEAGVNLIGYTTWGCIDLVSAGTGEMRKRYGFIYVDKDDEGKGSFERSKKDSFY
WYKKVIASNGKDLD

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	8	190	4.8e-53	0.3776223776223776

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	4.23e-91	2	193	283	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	3.58e-83	4	194	284	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	1.87e-81	2	194	284	478	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	6.37e-75	1	194	268	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK15014	PRK15014	5.47e-68	2	193	285	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK22871.1	1.80e-111	1	194	297	490
BBK23063.1	1.80e-111	1	194	297	490
BBK62639.1	5.12e-111	1	194	297	490
QGT98326.1	2.92e-110	1	194	297	490
ARW74425.1	2.92e-110	1	194	297	490

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F66_A	1.63e-74	2	193	286	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	4.57e-74	2	193	286	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
6WGD_A	1.21e-71	4	193	279	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
3PN8_A	1.58e-71	2	193	286	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
2XHY_A	1.28e-66	2	193	287	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	7.35e-70	4	193	279	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	5.01e-68	1	194	275	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q48409	2.25e-67	4	193	273	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P42973	2.28e-67	5	193	288	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P26206	4.57e-67	4	193	274	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000018	0.000017	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001421_01727.