CAZyme Information: MGYG000001422_01584

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_01584
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000001422_1|CGC31	43162.2	6.9269

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 1819339; End: 1820466 Strand: -

Full Sequence      

MKKKLLGVFLFMSLICGSAVAQELPDKKETLKNLVKVNDYFMKKYADYRTPSYNGIIRPS
NIWTRAVYYEGLMALYSIFPREEYYDYTYQWADYHKWGMRNGNTTRNADDQCCGQVYIDL
YNMSSDPEKIRKIKASIDMVVNAPQVNDWTWVDAIQMAMPIYAKLGKLTGEQKYNDKMWE
MYSYSRNVHGKNGLFNPKDGLWWRDADFVPPYKEPNGEDCYWSRGNGWAYAALVRVLEEI
PADELHRADYINDFLAMSKALKKCQRTDGFWNVSLHDETNFGGKETSGTALFVYGMAWGV
RKGLLDKKEYLPVLLKAWNAMVQDAVHPNGCLGYVQGTGKEPKDGQPVTYDKVPDFEDYG
VGCFLLAGAEVYKLN

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	59	373	2.1e-90	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.85e-110	35	374	3	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	7.39e-52	41	374	11	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO69334.1	7.19e-284	1	375	1	375
ALJ61451.1	6.26e-269	1	375	1	375
QUT92974.1	2.55e-268	1	375	1	375
QRM98498.1	2.78e-241	1	375	1	379
QUT32919.1	2.78e-241	1	375	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	2.47e-72	4	370	2	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.49e-64	21	370	3	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	2.91e-45	149	375	152	370	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	4.63e-15	59	374	35	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.91e-14	59	374	25	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	4.88e-45	1	375	1	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	1.87e-44	149	375	159	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	1.66e-38	47	375	76	412	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	2.53e-14	59	374	35	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000855	0.969359	0.029047	0.000267	0.000243	0.000225

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001422_01584.