CAZyme Information: MGYG000001422_01837

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_01837
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000001422_2|CGC3	43814.61	5.2188

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 158168; End: 159310 Strand: -

Full Sequence      

MKQSNSLFFIAVLLSLVSCAKMEEKRYMPVNKNAMPEVVQLLDFLYSIQGKYTLTGIHNF
ASDINRYDQVVDSLTGKTPVIWGSDFSFNALGENQCDFRHCGPLNLTVPGNRTVPCEVLN
LSTTQQRQLIVDAAIKKYHEGRIITLMWHCCWPTNGDDCNGDDIWRWADNLPSQEEWDEL
TTDGTELNNLWKKQMDGIAVYLKQLQAAGVPVLWRPFHEMNGVWFWWCNKPGENGFKKLW
ISMYNYLTDYHKLNNLLWVWNTNAPRNNPGDEAGPYADYYPGSDYVDVLAADVYHADWKQ
SHHDELVALGKGKIISLGEVGALPSTEVYENQPQWSWFMPWGYFILNSDNVKIAKDIYNH
PRSVNLDMIDFSDQTYKLKK

Enzyme Prediction     

No EC number prediction in MGYG000001422_01837.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	30	367	1.7e-75	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	6.64e-41	30	367	1	310	Glycosyl hydrolase family 26.
COG4124	ManB2	6.17e-20	153	294	124	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL06294.1	1.69e-173	29	379	26	377
BBL01059.1	2.58e-168	15	380	12	378
AHM62992.1	1.52e-104	11	370	6	330
ALI98661.1	4.31e-104	5	367	3	326
QEC74531.1	8.49e-102	27	369	22	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q75_A	2.23e-105	29	374	23	332	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3ZM8_A	9.47e-39	31	369	147	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	1.79e-32	29	370	6	311	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	4.04e-31	130	366	116	345	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6D2X_A	2.39e-26	141	359	90	335	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	1.02e-35	31	369	176	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P55296	2.40e-34	30	367	158	458	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1
P55298	3.05e-33	30	377	157	468	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55297	5.80e-33	30	377	159	470	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P49425	3.23e-29	143	367	234	455	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000059	0.060308	0.939609	0.000019	0.000027	0.000022

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001422_01837.