CAZyme Information: MGYG000001422_02630

Basic Information

• Species: Bacteroides oleiciplenus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides oleiciplenus
• CAZyme ID: MGYG000001422_02630
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
893	MGYG000001422_2|CGC29	101507.05	8.2783

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001422	7071122	Isolate	not provided	Asia

• Gene Location: Start: 1330928; End: 1333609 Strand: +

Full Sequence      

MKRIYTIALMLSFCSLIFAQTYAIYDLKVNGKNNPVGVDNQDLVFSWKISSIERNFIQPS
YQIEVWDEQNNLVWNSKKVKSDNSIGVKYEGKSLKAGGYYTWIVRVGKVKSQIASFVIAL
NFDGAKWIGLENDKDNYKVVPGIHSPLVQHEIRDRKTGMYILPLLRRDFDIEKPVKRAVM
SLSGLGHFELFANGSKVGDHFLDPGWTDYSTNALYESFDVTDMLQKGKNTLGIMLGGGFY
NVPRERYYKQLISFGAPKAVGVLEMTYEDGAKERIVTDTEWLASHSPITYSSIYGGEDYD
KSLLQKGWNTPNFDASHWKSAVESKLNIELSAQKSEPLKVRNRFNVVKRYKNHKGNTIYD
FGQNMSGIIELKVKGKDGTIVRMHPAELLNKDSTTNQSASGAPYYFEYKISGDTVQEWRP
QFSYYGFRYIELDRTENLESIEINALHTTNSAREVGRFSCSSPMFNKVYELIDWSIRSNL
ASILTDCPHREKLGWLEVAHLMQYSMQYRYDLSTFYKKTIDDMAKAQYLDGMVPTIAPEY
VHFSDGFENTPEWGSAFIISSWYYYKWYADKTLLEKYYDKMSSYVDYLTSRSKGYIVAYG
LGDWYDLGPGTPGYAQLTTVGVTSTAIYYYDVTIMQRIAQLLGKKADSEKFGALGTKIKN
AFNKRYFNEQTKTYDRNSQTANAMALYMGLVEDQNKEIVLSNLITDIAGRDYALTAGDIG
YRYVLRALDDNNRNEVVYRMNSRYDVPGYGWQLAGGATALTESWQNYGFVSNNHCMLGHL
MEWFFSVLGGIKQSKNSVAFKELMIAPVLVSGINSAQTSLETSYGRVECRWKDETDGFSM
DVTIPPGSIATVVLPCPKDGKVMDAGRNVKVDKYDNGKAYIKIGSGNYKFTTK

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	352	854	2e-142	0.9920634920634921
CBM67	163	323	2.3e-33	0.8522727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.10e-100	453	788	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.64e-57	173	342	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	4.42e-21	355	433	6	85	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.08e-17	790	864	1	73	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	9.70e-05	557	699	344	503	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH54694.1	0.0	22	890	26	916
QNL36667.1	0.0	22	890	26	916
QUT50137.1	0.0	19	893	22	928
ANU58580.1	0.0	21	893	25	924
QQR16512.1	0.0	21	893	25	924

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.90e-153	19	890	27	939	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.52e-90	165	893	305	1031	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	5.03e-86	36	869	16	860	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	2.61e-123	29	854	37	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	5.89e-100	31	893	43	923	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	4.67e-93	27	890	34	908	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	3.41e-89	165	891	305	1029	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001357	0.996117	0.001763	0.000255	0.000236	0.000241

TMHMM  Annotations     

start	end
7	24