CAZyme Information: MGYG000001445_01625

Basic Information

• Species: Cedecea davisae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Cedecea; Cedecea davisae
• CAZyme ID: MGYG000001445_01625
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
790	MGYG000001445_1|CGC20	86016.02	5.7641

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001445	4852695	Isolate	not provided	not provided

• Gene Location: Start: 1709242; End: 1711614 Strand: +

Full Sequence      

MTVIYKDPQRPVAERVADLLARMTPEEKFAQMHAYWLVLSETGDHRERTDMSDEFAGVSE
QASLAQRLKSGVGQITRPLGTHIVEAKEGVRAANKLQKMLVEETRLGIPALFHEECLVGL
LCKDATLFPSSLNYGSTWDPALIRQAAMHIGEEARSTGCHQGLAPVLDVSRDVRWGRTEE
TFGEDPWLVGLMACAYVEGLQGKKRDLLATLKHYVGHSFSEGARNHAPVHLGFCELNDTF
LLPFEMAVKLSHAGSVMPAYHDIDNQPGHSDGFLMTDILREQWGFDGIIVADYGGVSLLH
QHHGVARDAAESAALAFNAGLDVELPKDDCVRHLGDAVERGLISMAKIDEIVARTLAVKF
QLGLFERPYADETKVVLQSKQARQVARDVATRSVTLLENRAAIPLAENQRMAVIGPTADD
PLALLSGYSFPVHLIISDMLEETTQVTTPLAALRHYLGDEKVSYAKGCHIIEKRMAGAPV
FPGDSSGKPIQHSPVSLDTSLIAQAVRTAEQSDIVVACVGDLAGLFQSGTVGEGSDTDSL
NLPGVQQQLLEALVATGKPVIVVMTGGRPYNLGGLEDKFSALIIAWAPGQEGGWAIADVL
TGRAEPQGRLTVSIPKSAGAMPYYYNHKLKSGGTPYAFHFGSRYPFGYGKSWTSFSYSPI
TLRGKTVAIDGEITLSVTVTNTGERSGSEVVQLYVRDNVASMVRPVKELKGFERVELEAG
ESATLTFILPVDMLNFTARSGKRIVEPGEFTLMVGASSEDIRETTQVEVLGETRTLPKIW
RMLSHCEVSR

Enzyme Prediction     

EC	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	102	326	2.2e-62	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.66e-175	16	765	38	761	beta-glucosidase BglX.
COG1472	BglX	6.53e-82	23	421	1	367	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.32e-73	24	358	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	8.10e-72	105	755	78	769	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	2.06e-51	394	652	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX98165.1	0.0	1	790	1	790
CCO21415.1	0.0	1	788	1	788
CCO21524.1	0.0	1	788	1	788
QKN81637.1	0.0	1	789	1	789
QJT80454.1	0.0	1	790	1	790

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	1.08e-135	5	764	36	780	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5Z9S_A	3.00e-130	2	765	14	784	Functionaland Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]
5XXL_A	1.74e-129	6	762	5	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	9.54e-129	6	762	5	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5YOT_A	7.93e-124	5	762	7	749	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	4.05e-124	16	763	38	759	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.12e-123	16	763	38	759	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	3.99e-118	65	759	23	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	1.01e-110	5	765	29	751	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	5.16e-83	3	761	28	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001445_01625.