CAZyme Information: MGYG000001445_01928

Basic Information

• Species: Cedecea davisae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Cedecea; Cedecea davisae
• CAZyme ID: MGYG000001445_01928
• CAZy Family: PL7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
263		28587.96	8.7553

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001445	4852695	Isolate	not provided	not provided

• Gene Location: Start: 2060037; End: 2060828 Strand: +

Full Sequence      

MKSKSQLYGLTSGLLLAALSASAWAKSEQGAPGENYPVLTQSYLLQSFDSSQKVKEEKIT
PELQNQYFYSNCGGSKGCDSALPEGAIMFKAPSGFGSTAHSEFPRVELRATQNFVNGSEF
NNEQSGSVYIVQAPSTRSIIFAQIHGDKPGGSEMFKLRWENGAVVAGVKENYGDAEKRST
LLSGIGLNEKIDYKLKAKGTSGGMKVTIEVSADGKTASKTFSYPEQGWKGVQLYFKAGNY
NQDKDRDGTEAKVAYSKLDVRYQ

Enzyme Prediction     

No EC number prediction in MGYG000001445_01928.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL7	83	260	2e-32	0.8138528138528138

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08787	Alginate_lyase2	9.71e-34	57	260	18	220	Alginate lyase. Alginate lyases are enzymes that degrade the linear polysaccharide alignate. They cleave the glycosidic linkage of alignate through a beta-elimination reaction. This family forms an all beta fold and is different to all alpha fold of pfam05426.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX97901.1	5.26e-186	1	263	1	261
AIR66479.1	1.82e-150	1	263	1	263
AIR62230.1	7.40e-150	1	263	1	263
AIR03199.1	1.05e-149	1	263	1	263
AJZ89632.1	1.66e-146	1	263	1	263

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2CWS_A	4.03e-19	31	262	5	227	Crystalstructure at 1.0 A of alginate lyase A1-II', a member of polysaccharide lyase family-7 [Sphingomonas sp. A1],2Z42_A Crystal Structure of Family 7 Alginate Lyase A1-II' from Sphingomonas sp. A1 [Sphingomonas sp.]
2ZAB_A	1.46e-18	31	262	4	226	ChainA, Alginate lyase [Sphingomonas sp. A1],2ZAC_A Chain A, Alginate lyase [Sphingomonas sp. A1]
2ZA9_A	2.03e-18	31	262	4	226	ChainA, Alginate lyase [unidentified]
2ZAA_A	1.43e-17	31	262	4	226	ChainA, Alginate lyase [Sphingomonas sp. A1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000672	0.997670	0.001027	0.000244	0.000198	0.000169

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001445_01928.