CAZyme Information: MGYG000001455.1_00693

Basic Information

• Species: Faecalitalea cylindroides
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Faecalitalea; Faecalitalea cylindroides
• CAZyme ID: MGYG000001455.1_00693
• CAZy Family: GT51
• CAZyme Description: Monofunctional glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
237	MGYG000001455.1_38|CGC1	26625.32	4.7542

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001455.1	1944068	Isolate	not provided	not provided

• Gene Location: Start: 36216; End: 36929 Strand: +

Full Sequence      

MKKFLIRLIVFLLILLLGLAGFLGVRGYSGYREITSQAPVETVVEQVQSSPTFVPYEDLP
SDLIRATVSIEDRRFYEHGGIDYIGLARGTLSQVIPQLAQSGGSTITQQVAKNLYGMFEQ
TLDRKLVEMFIAKELESKYTKNQILALYVNIINYGDYHFGIYEASTGYFGVEPQYLTLAQ
ASLLAGLPQSPGNYQLSDHFQQAKARQHQVLEAMAECSYINESDIETIYAQDVYATY

Enzyme Prediction     

No EC number prediction in MGYG000001455.1_00693.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	46	214	3.1e-57	0.9548022598870056

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	8.31e-70	52	215	14	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	1.66e-58	52	237	3	186	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.63e-56	52	227	77	253	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.46e-52	53	237	69	253	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	6.97e-41	53	222	60	228	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK88892.1	3.29e-147	1	237	1	237
AMK54179.1	5.37e-63	1	234	1	234
BBK61494.1	6.78e-62	32	228	31	227
BBK21420.1	1.36e-61	32	228	31	227
QNM12078.1	7.99e-61	32	228	31	227

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UDF_A	1.73e-31	54	233	42	221	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
3NB6_A	7.88e-31	53	226	22	195	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	1.11e-30	53	226	22	195	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	1.98e-28	44	231	50	243	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	2.31e-28	44	231	14	207	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q07259	2.38e-34	37	226	33	221	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
P40750	4.04e-31	54	233	79	258	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2
Q8CNQ3	2.08e-30	34	231	64	266	Monofunctional glycosyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=mgt PE=3 SV=1
Q5HN60	2.08e-30	34	231	64	266	Monofunctional glycosyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=mgt PE=3 SV=1
P0A0Z6	3.42e-30	53	216	70	233	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.984239	0.011207	0.004202	0.000049	0.000031	0.000282

TMHMM  Annotations     

start	end
5	27