CAZyme Information: MGYG000001455.1_01353

Basic Information

• Species: Faecalitalea cylindroides
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Faecalitalea; Faecalitalea cylindroides
• CAZyme ID: MGYG000001455.1_01353
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492	MGYG000001455.1_74|CGC1	56895.55	4.8119

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001455.1	1944068	Isolate	not provided	not provided

• Gene Location: Start: 17227; End: 18705 Strand: -

Full Sequence      

MQKNKFPKDFLWGGAVAANQCEGAWLEDGKLPNVTDVLVGIIRSGNNPSIKWNEEKQIWE
MNLDPEKQYLSHDGIDFYHRFKEDLTLMSEMGFKAFRTSISWARIFPRGDEEEPNEKGLQ
FYDQMIDTMIDLGMEPVITLSHYETPLALIAEYGGWTNRKLIGFFEKYVRTVLTRYKGKV
KYWLTFNEINNAFKIPFAAAGVVSFPPTNPDEPMADVDEKMIYQACHHMFVANSLAVKAC
REIDPEAHMGVMCSFSHIATYPENSDPENVVGTHLFKRKHYFYTDVMCRGHYPKYILNEW
ESKEIAPVMEQGDEETLAKYTNDYIAFSYYRSSVYSKNVEMKSDTGGAIGLSNPYLKESS
PEPWKWPIDPVGFRLVCDELYDRYELPLFPVENGIGLKEDETDGMIEDPAREKYLRMHLE
EMAKAIEDGCEILGYLWWGPIDIVSAGTGEMKKRYGFIYVDRFNDGTGDLHRSKKKSFEY
YKRIIETNGEEI

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	489	1.6e-136	0.993006993006993

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	0.0	3	491	1	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	2.05e-175	5	492	3	476	6-phospho-beta-glucosidase; Reviewed
PRK09593	arb	3.93e-173	1	492	1	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	2.52e-172	1	492	1	477	6-phospho-beta-glucosidase BglA; Provisional
PRK09852	PRK09852	2.53e-172	3	492	1	473	cryptic 6-phospho-beta-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMB97653.1	1.53e-274	6	492	7	492
APE41164.1	1.21e-255	1	492	1	491
AOM37866.1	1.21e-255	1	492	1	491
AVL45433.1	1.21e-255	1	492	1	491
QMV93696.1	1.21e-255	1	492	1	491

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	2.82e-166	2	492	4	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	5.97e-163	1	492	3	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4IPL_A	2.18e-157	6	492	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
4F66_A	2.43e-144	4	492	5	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	6.89e-144	4	492	5	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	4.39e-165	3	492	5	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46829	3.27e-162	1	492	3	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q46130	3.01e-156	6	492	7	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P42973	5.22e-156	7	492	5	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q48409	7.84e-144	6	489	4	459	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001455.1_01353.