CAZyme Information: MGYG000001460_00966

Basic Information

• Species: Romboutsia dakarensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Romboutsia; Romboutsia dakarensis
• CAZyme ID: MGYG000001460_00966
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459	MGYG000001460_47|CGC1	52911.95	4.9248

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001460	3735762	Isolate	not provided	not provided

• Gene Location: Start: 22178; End: 23557 Strand: +

Full Sequence      

MGLRKDFLWGGATAANQCEGGYKEGGRGLANVDVAPHGKDRFPVLAGKMKMFECDDEHYY
PAHEAIDMYHNYKEDIKLFAEMGFKCYRLSIAWTRIFPTGEETTPNEEGLKFYEDLFNEC
LKYGIEPLVTICHFDVPMHLVEKYGAWRDRKLVDLYVKYCEAIFNRYKDKVKYWLTFNEI
NMILHLPFIGAGLYIEEGENEEQIKYQAAHHQLVASALVTELAREINPDFKIGCMLAAGN
TYANTCHPEDVFKSMEKDRENYFFIDIQSRGEYPAYAIKELERKGINIVMEEDDKKILKE
NTVDFISFSYYSSRLTSADPEVNAQTEGNVFATLRNPHLKASEWGWQIDPLGLRITMNSL
YDRYQKPLFIVENGLGAVDTPDENGNVYDDYRIDYLREHIKTMIDAVELDGVDLLGYTSW
GCIDLVSASTGEMKKRYGFIYVDKDNDGSGTLKRSKRKF

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	457	7e-141	0.9533799533799534

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	458	2	460	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	5	458	6	457	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	1	458	4	461	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	5	458	6	441	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	458	4	461	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGD88872.1	0.0	1	458	1	458
CAJ69988.1	0.0	1	458	1	458
ARE64037.1	0.0	1	458	1	458
AYD22664.1	0.0	1	458	1	458
AXB66007.1	0.0	1	458	1	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	4.05e-204	7	458	12	453	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	3.84e-185	3	458	8	463	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	4.95e-181	3	457	7	463	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.41e-180	3	457	7	463	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	6.15e-177	3	457	7	463	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	5.61e-217	5	458	6	457	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	3.97e-199	7	458	12	453	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	1.71e-184	1	458	5	455	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q46829	2.10e-184	3	458	8	463	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	1.99e-177	3	457	4	462	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001460_00966.