CAZyme Information: MGYG000001479_01654

Basic Information

• Species: Clostridium_AA polynesiense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_AA; Clostridium_AA polynesiense
• CAZyme ID: MGYG000001479_01654
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
227		25662.2	8.9969

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001479	3560738	Isolate	not provided	not provided

• Gene Location: Start: 17484; End: 18167 Strand: -

Full Sequence      

MNVNKPEQILGLQILSSFMKKSLGDGPAFDLVLEALIKSSSQNDNFNIFDSHSNSRGENL
NSLPINIKNQEKTDELKGAAYKPGAVINKNSSEKMEIINRAVDKYSKEYDVDSKLIHAII
KQESNYNPNSVSKAGAMGLMQLMPENCVEDGVKDPFDIEDNIRGGIKQFKGYLNRYKDIE
MSLMAYNAGPGTVKRRGVKSIDDVYKMPKETQHYVKKVMNYYREYSK

Enzyme Prediction     

No EC number prediction in MGYG000001479_01654.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	114	225	8.9e-30	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	1.63e-44	114	223	2	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	7.45e-38	102	223	8	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	7.04e-33	101	227	9	151	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd13403	MLTF-like	3.52e-28	104	227	3	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.72e-27	87	227	128	285	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR22544.1	3.63e-57	16	223	25	242
ASW42335.1	2.25e-56	1	225	1	245
AYE35853.1	2.61e-55	19	223	8	234
QAS62160.1	2.61e-55	19	223	8	234
QAA31200.1	2.80e-55	1	223	1	248

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.91e-06	102	219	420	549	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.91e-06	102	219	424	553	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.92e-06	102	219	434	563	Lytictransglycosylase in action [Neisseria meningitidis]
6FPN_B	1.92e-06	102	219	430	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O29_A	1.93e-06	102	219	440	569	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	2.62e-27	98	222	60	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	3.77e-18	98	222	1426	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	3.77e-18	98	222	1426	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	1.91e-13	106	189	15	98	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
A8ZWR8	9.39e-10	97	194	289	389	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001479_01654.