CAZyme Information: MGYG000001483_00823

Basic Information

• Species: Arachnia massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Propionibacteriaceae; Arachnia; Arachnia massiliensis
• CAZyme ID: MGYG000001483_00823
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
660		69543.45	4.253

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001483	3211248	Isolate	not provided	not provided

• Gene Location: Start: 253990; End: 255972 Strand: +

Full Sequence      

MAQGGLGQRLAKAGAALIALGALLIGVPWFLLQFANPAYLLQVDWVDALTVGADSRLILA
LLGTIAWVAWAVVALTILFEFVAVLSRQRIRIRLPGTAWLRPAIGALVLTAVAAPTMASA
DTGVAAPPVEAHLPPPVIASAEPGTPTSMTETATAGRSYEVQPGDELWSIAERELGSGER
WRDIVALNPGVTESSRLSPGAALQLPQDEPPAPTVVVEEGDTLWHIAEDQLGDPHRWPEI
HQANLHQIQDPDQIDVGWELQLPPSADEAPPPPPEPTPGPAAAPAASGAMGIDDLRVPDP
PLEERRGSAADAVRESFPSTPQATTAPTDGGASAVEHAGTSPVDVHDTDADMDEDQTDYQ
GLLLPVGAALAGAVLLGVATRRRTQVLARAVGRRLVPVPAQVARFWTALAHRSEDRTVEP
TDPTPTTLVLGWEGDEAVQLDVEAERAVMFTGGEAASALGAAITGLACTPWASEAELIIV
DGDDWVEALDDPRISGEPSTAEGLTRLARLCSERRLALRQRTLAAARADENLAEAFAPTV
VIFLSPLTAAELDAVGDALALGDVGVSVLAATADPLQHAFTYVHVGAEQATLRGRRFAPQ
LVSTPARRALVELFAATGQLDTEPAPWWKDDDDLPPNVLPLPRHGLDRPGHTPSSCCSER

Enzyme Prediction     

No EC number prediction in MGYG000001483_00823.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11198	PRK11198	4.53e-08	203	254	86	137	LysM domain/BON superfamily protein; Provisional
cd00118	LysM	2.28e-06	157	205	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
cd00118	LysM	7.30e-05	214	262	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
PRK11198	PRK11198	1.99e-04	148	207	87	147	LysM domain/BON superfamily protein; Provisional
COG3170	FimV	0.001	106	206	137	246	Tfp pilus assembly protein FimV [Cell motility, Extracellular structures].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTO37425.1	2.76e-235	6	653	4	646
AQP50973.1	7.50e-177	8	643	1	643
QNP55612.1	2.84e-169	8	643	1	629
VEP40458.1	5.20e-166	8	644	1	625
AQX15971.1	5.20e-166	8	644	1	625

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35
63	85
98	120