CAZyme Information: MGYG000001493_04151

Basic Information

• Species: Enterocloster bolteae
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster bolteae
• CAZyme ID: MGYG000001493_04151
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334		36850.5	4.7381

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001493	6583702	Isolate	not provided	not provided

• Gene Location: Start: 228140; End: 229144 Strand: +

Full Sequence      

MKLRHLFFACSGVFVMMFSMLLLVVIVFSDEEDGGSGGNLIYGGVSVSQEVLAHKPMLEK
YAREYGIEEYLNVLLAIIQVESGGTLEDVMQSSESLGIPPNSLNTEESIKQGCKYFSELL
TAAETKGCDLNSVIQSYNYGGGFLDYVAGHGKKYTFELAESFAREKSGGKKVTYTNPVAV
EKNGGWRYSYGNMFYVFLVSEYLTVAQFDDETVQAIMEEALKYEGWTYVYGGDSPSTSFD
CSGLVQWCYGKAGIALPRTAQEQYNVTQHIPLSEAKAGDLVFFHSTYNAGTYITHVGLYV
GNNQMYHAGNPIGYADLTGSYWQQHLAGAGRIKQ

Enzyme Prediction     

No EC number prediction in MGYG000001493_04151.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	3.81e-76	48	203	1	165	Lysozyme-like.
cd16891	CwlT-like	1.41e-69	54	203	1	150	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam00877	NLPC_P60	3.85e-38	225	331	1	105	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
PRK13914	PRK13914	7.75e-33	212	332	365	481	invasion associated endopeptidase.
COG0791	Spr	4.18e-28	212	329	74	196	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX92318.1	6.61e-232	1	334	1	334
ASN93631.2	6.61e-232	1	334	1	334
QRP41712.1	6.61e-232	1	334	1	334
AJP13109.1	3.51e-227	1	334	1	334
ARE64288.1	3.51e-227	1	334	1	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	1.07e-163	44	334	17	308	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	5.70e-153	43	332	18	310	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
7CFL_A	4.46e-15	225	332	26	137	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
3PBI_A	1.02e-13	211	318	83	197	ChainA, Invasion Protein [Mycobacterium tuberculosis]
2K1G_A	1.39e-13	216	332	9	123	SolutionNMR structure of lipoprotein spr from Escherichia coli K12. Northeast Structural Genomics target ER541-37-162 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96645	1.28e-74	42	333	48	329	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
P21171	1.74e-23	216	332	372	484	Probable endopeptidase p60 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=iap PE=1 SV=2
Q01839	9.82e-23	216	332	412	524	Probable endopeptidase p60 OS=Listeria welshimeri OX=1643 GN=iap PE=3 SV=1
Q01836	1.00e-22	215	332	354	467	Probable endopeptidase p60 OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=iap PE=3 SV=2
O34636	1.25e-22	47	201	48	202	Uncharacterized membrane protein YocA OS=Bacillus subtilis (strain 168) OX=224308 GN=yocA PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999933	0.000029	0.000054	0.000000	0.000000	0.000015

TMHMM  Annotations     

start	end
7	29