CAZyme Information: MGYG000001511_00312

Basic Information

• Species: Massilibacterium senegalense
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_E; Massilibacteriaceae; Massilibacterium; Massilibacterium senegalense
• CAZyme ID: MGYG000001511_00312
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341		37968.83	5.1649

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001511	2848543	Isolate	not provided	not provided

• Gene Location: Start: 175261; End: 176286 Strand: -

Full Sequence      

MKVMRLKIMLITYGVGFLLFFGLLVFVALFITNEDDSSGRNYSDMDGGGSVSVSADVLKY
RPMVEKYAKEYGVSEYVSTLLAIMEVESGGRLIDVMQSSESMGLPPNTLDSEEASIKQGV
KYFADLIQLAESKGVDGNTVIQAYNYGGGFIDYVTQRGKKYSFDLAQSFAKKHSGGSKTT
YSNPIAIKKNGGWRYLYGNMFYVDLVNQYFHAPQFDGDLVQLVMDEALKYEGYPYVFGGD
NPNTSFDCSGLTQWSYQKAGINLPRTAQQQYDFTEHIPLSEAKPGDLVFFHSTYNSGTYV
THVGIYLGDNQMYNAGDPIGYADLTTAYWQKHLIGAGRMKQ

Enzyme Prediction     

No EC number prediction in MGYG000001511_00312.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16891	CwlT-like	2.29e-74	60	210	1	150	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam13702	Lysozyme_like	9.43e-73	54	209	1	164	Lysozyme-like.
pfam00877	NLPC_P60	1.04e-36	232	338	1	105	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
PRK13914	PRK13914	4.77e-32	223	339	369	481	invasion associated endopeptidase.
COG0791	Spr	1.13e-29	216	336	71	196	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTY18374.1	2.79e-229	4	341	1	338
QNM45167.1	4.93e-198	1	341	1	339
AST98501.1	1.04e-196	4	341	1	336
API94179.1	2.00e-194	4	341	1	336
ASF30823.1	3.84e-192	4	341	1	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	2.78e-149	36	341	3	308	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	2.04e-138	34	339	2	310	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
7CFL_A	2.01e-17	223	339	17	137	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
2HBW_A	5.91e-14	226	339	107	226	ChainA, NLP/P60 protein [Trichormus variabilis ATCC 29413]
2K1G_A	1.46e-13	218	339	4	123	SolutionNMR structure of lipoprotein spr from Escherichia coli K12. Northeast Structural Genomics target ER541-37-162 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96645	9.75e-82	13	340	12	329	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
P21171	1.67e-24	223	339	372	484	Probable endopeptidase p60 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=iap PE=1 SV=2
O34636	3.80e-24	60	208	55	202	Uncharacterized membrane protein YocA OS=Bacillus subtilis (strain 168) OX=224308 GN=yocA PE=4 SV=1
Q01836	5.14e-24	226	339	358	467	Probable endopeptidase p60 OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=iap PE=3 SV=2
Q01839	9.72e-24	226	339	415	524	Probable endopeptidase p60 OS=Listeria welshimeri OX=1643 GN=iap PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999827	0.000125	0.000005	0.000001	0.000000	0.000069

TMHMM  Annotations     

start	end
9	31