CAZyme Information: MGYG000001518_02418

Basic Information

• Species: Gorillibacterium timonense
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Gorillibacterium; Gorillibacterium timonense
• CAZyme ID: MGYG000001518_02418
• CAZy Family: GT8
• CAZyme Description: General stress protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
274	MGYG000001518_6|CGC11	32452.49	6.979

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001518	5263339	Isolate	not provided	not provided

• Gene Location: Start: 975231; End: 976055 Strand: -

Full Sequence      

MSVSILVTLNSNYIRPLKVMLKSLFVQHPAATFDIYLLHSSILPEEIADLEQYTSMEGHR
LIAVTVDETYFSDAPVVKHYSKEMYYRILAFRFLPPELDKILYLDPDLMIINDILPLYET
DLEDFLFAAAFHDRIPLTEINRLRLKTQELPAYYNSGVLLMNLRLQRETVREKDIFDYVQ
DNKKWLILPDQDVLNALYSTSIKNIEELRYNYDARFYRYYKLASGGKVDMDYVVRNTSII
HFCGKRKPWNKHYSGSFHSLYKHYEKLAFPSLMR

Enzyme Prediction     

No EC number prediction in MGYG000001518_02418.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	4	252	1.8e-47	0.8754863813229572

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	3.09e-73	3	251	1	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
COG1442	RfaJ	1.20e-33	1	263	1	258	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01501	Glyco_transf_8	9.11e-28	5	250	2	249	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
cd00505	Glyco_transf_8	2.39e-22	7	251	6	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
PRK15171	PRK15171	2.38e-13	12	251	35	272	lipopolysaccharide 3-alpha-galactosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQS56048.1	1.78e-131	4	270	2	268
AIQ66096.1	4.83e-129	4	270	2	268
ADU73921.1	2.23e-121	4	268	3	267
ALX07859.1	2.23e-121	4	268	3	267
ABN52628.1	2.23e-121	4	268	3	267

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TZT_A	5.95e-69	4	268	7	271	Thestructure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548],3TZT_B The structure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548]
1G9R_A	9.18e-17	10	251	8	254	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
1SS9_A	6.05e-16	10	251	8	254	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
5GVW_A	7.94e-10	13	273	16	259	Crystalstructure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_B Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_C Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_D Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]
5GVV_A	1.43e-09	13	264	16	250	Crystalstructure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25148	6.21e-19	10	264	14	270	General stress protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=gspA PE=1 SV=2
P27129	4.98e-14	10	251	35	274	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
A0A0H2URH2	7.59e-13	4	272	4	252	Glycosyltransferase GlyF OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyF PE=3 SV=1
P19817	1.20e-11	75	250	97	271	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4
A0A0H2URJ6	4.35e-09	13	273	16	259	Glycosyltransferase GlyE OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001518_02418.