CAZyme Information: MGYG000001599_00310

Basic Information

• Species: Phocaeicola sp900544075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900544075
• CAZyme ID: MGYG000001599_00310
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1001		112071.84	7.9807

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001599	4213385	MAG	China	Asia

• Gene Location: Start: 123859; End: 126864 Strand: +

Full Sequence      

MKSIKVLLSTVLCFCILLVENGYSKNITENSKIIKILSIGNSFSQDAVEQYLHELGEAEG
YQFVIGNLFIAGCSLERHVKNIRKDAAAYDYRKIGFDGKKVHHGNMSISKALADEKWDYV
SLQQTSSFSGMYDTYETSLPELYGYVKERIDKRSKIVFHQTWAYAKNCRNTGFKKYDNNQ
ITMYKAIVETVKKAGKLVDFYRIIPSGTAIQNARTSFIGDHLNRDGYHLDVNVGRYIAAC
TWFEVLTGKNVIGNKFVPENVSEEYREIAQLAAHEAVRHPNKITDLSYIKDNSLYKNPSV
PVDMRVNDLLSRMTLEEKIYQLNQYILGRNNNVNNIGETVKNIPAEIGSLIYFEANPNMR
NSVQKKALNESRLGIPILFGYDVIHGFRTIYPISLGQAASWNPKLVENACGVAAQEAFTS
GVNWTFSPMVDVARDGRWGRVSEGYGEDPYVNGVFAAASVRGYQGDTLSAKNRIAACLKH
YVGYGASEAGRDYVPTEISKQTLWDTYLPPFEAGIKAGAATVMSAFNNISGIPASANYYT
LTEILKKRWKHRGFVVSDWDAVKQLITQGLAANEKEAAWYAFSAGLEMDMKDNCYQKHLG
KLVKEGKVSMAAIDDAVGRILRLKFELGLFENPYTEVLPDNSRFLLPSSLNVAEQLAQES
MVLLKNDKGVLPLKKEQKIAFIGPMANNRLHLLGSWSAHGDEKDVVSILDGIKKEKGFIE
KNILFAEGCGFDGNDQSNFAEAIGVAEQADIIIACLGEKKTWSGENASRSVISLPQIQEE
LLEKLKKTGKPLVVLLSSGRPLDLSRIEPLADAMLEIWQPGVTAGTAVAGILSGRYNPSG
KLPITFPYTTGQIPIYYNQRKSGRTHQGKYQDITSEPLYSFGHGLSYTKLEYGALKLSSY
KVRRGDTLRAEIEVKNTGDYDAKETLLWFISDPFSSITRPVKELKYFEKKEIPIGESRIF
TFDVDLERDFGFVNEDGKRFLENGIFYIIVKDQKVKVELVD

Enzyme Prediction     

No EC number prediction in MGYG000001599_00310.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	369	590	6.6e-68	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	306	996	38	758	beta-glucosidase BglX.
pfam16227	DUF4886	7.29e-144	35	283	1	250	Domain of unknown function (DUF4886). This domain is mainly found in uncharacterized proteins around 290 residues in length and is mainly found in various Bacteroides species. It has a curved central beta sheet flanked by helices. Distant homolog analysis showed it has a similarity with GDSL-like Lipase/Acylhydrose family. The function of this domain is still unknown.
COG1472	BglX	2.43e-100	313	717	1	388	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	4.75e-85	297	992	44	770	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	4.79e-81	314	623	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB39105.1	0.0	31	997	5	970
QQR08785.1	0.0	31	997	22	987
ANU64819.2	0.0	31	997	5	970
QUT31469.1	0.0	290	1001	25	735
QRM99762.1	0.0	290	1001	25	735

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6R5I_A	6.86e-164	306	990	7	718	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	3.57e-163	298	990	31	750	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	3.79e-163	306	990	7	718	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5R_A	3.90e-163	306	990	8	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
5XXL_A	1.20e-162	302	990	10	737	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	2.72e-166	289	998	19	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	2.52e-163	289	998	19	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
A7LXU3	1.23e-111	297	993	26	764	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
T2KMH0	1.89e-110	297	990	28	706	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	6.59e-105	295	995	29	745	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000263	0.999075	0.000189	0.000147	0.000143	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001599_00310.