CAZyme Information: MGYG000001622_01098

Basic Information

• Species: Enterocloster sp900549235
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900549235
• CAZyme ID: MGYG000001622_01098
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000001622_4|CGC1	42294.16	5.0257

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001622	3555335	MAG	China	Asia

• Gene Location: Start: 12459; End: 13583 Strand: -

Full Sequence      

MTSELLQQKTELTAHKLLNLGGADYEQDKHISLEEAMATGNVARDFGIEEWDWPQGVGLY
GLYMLQEHTGRSFLDFFESWFQNNIKRGLPSRNINTTAPYLTLLQIMDRLPEKELYEAMC
IKQAEWLMNELPKTKDNGFQHVTSGIGDRNGVILNEGQLWADTLFMAVLFLQQMGNRYNR
KEWKDEALHQVLIHIKYLYDKNSGLLYHGYSFLRNDNFGGIFWCRGNSWFTLGITLYLEQ
AEDMEQGTRQFLLDTFKTHAEALKRCQADSGLFHTILDDPPSYEEASGTAAITAGLIRGI
RLGLLDETFIPCVRQAVKGLCGCVDTDGTVLKVSAGTAMGMDAEHYKHIGIRPMAYGQAL
TLIAFAEALESGMF

Enzyme Prediction     

No EC number prediction in MGYG000001622_01098.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	368	2.1e-89	0.9608433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.23e-88	50	369	33	350	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	4.38e-80	50	369	26	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SEU08345.1	3.72e-162	1	370	1	370
QHQ63096.1	1.51e-161	1	370	1	370
AIQ71725.1	5.17e-160	1	370	1	371
QUL56643.1	4.57e-157	1	370	1	371
AIQ40335.1	1.14e-156	1	370	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	6.44e-69	40	371	54	379	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.25e-66	40	370	55	379	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	1.51e-64	37	367	33	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	1.68e-18	37	320	8	298	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	3.28e-44	25	371	6	338	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001622_01098.