CAZyme Information: MGYG000001743_00435

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-884
• CAZyme ID: MGYG000001743_00435
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336		39466.76	5.5387

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001743	1187428	MAG	Sweden	Europe

• Gene Location: Start: 19; End: 1029 Strand: +

Full Sequence      

MSEADGIYVLDTGSTDNTVQLLLNEGVNVVSKKIVPWRFDVARNESLKLVPTDADICVCT
DLDELFEPGWREKLENTWEIGVNRVLYTYNWSINDKGIPVVTFFREKIHDRFNYKWVYPV
HEIPEFTGENEVVKTNEEIVLNHFPDTSKSRGSYLNLLELSVKENPNDDRNLHYLGREYM
YYGKWNECIDTLIKHLKLKSATWKDERSASMRFIARAYVGLGRLDEANLYLDKAIEEAPY
LRDPYVEKALLSYNNGDYKNAEKYLKKALKIKKHEKTYINETFSWDNTIYDLLSICTFYN
GKFSESLKWVNKAILIESNERLLNNKKIIEEYIKNN

Enzyme Prediction     

No EC number prediction in MGYG000001743_00435.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
sd00006	TPR	2.79e-10	172	270	4	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	7.86e-09	214	314	7	96	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
cd02511	Beta4Glucosyltransferase	2.26e-06	4	145	26	165	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
pfam13424	TPR_12	3.38e-05	206	273	1	76	Tetratricopeptide repeat.
sd00006	TPR	2.30e-04	155	236	21	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQS58818.1	1.29e-112	1	330	26	357
AQS58819.1	1.35e-107	1	330	26	357
QPK53673.1	1.44e-103	1	292	29	321
QDA27929.1	1.44e-103	1	292	29	321
QPK58759.1	1.44e-103	1	292	29	321

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001743_00435.