CAZyme Information: MGYG000001748_01010

Basic Information

• Species: CAG-56 sp900762665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-56; CAG-56 sp900762665
• CAZyme ID: MGYG000001748_01010
• CAZy Family: GH4
• CAZyme Description: Alpha-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
448	MGYG000001748_8|CGC1	51523.1	6.1415

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001748	4218051	MAG	Sweden	Europe

• Gene Location: Start: 122563; End: 123909 Strand: -

Full Sequence      

MSVKISLIGAGSGTFSINLVKDLCLARNLADSTISLMDVDEERLNDVYRFCVRYAEEVGA
ALKIEKTMDRKESMRNADFVVNTALVGGYCRLWDGWKIAKKWGYHFGGSFHIVHDEAFWV
NFYQIKLMEEIYLDIQKVCPNAWYVLVANPVMAGTTYLQRKYPGIRMVGMCHGYGGVYWL
AKLLGMDREKMNFQAPGINHFVWLNSFTYEGRDAFEILDQWIAKHSDEYFKTCPASDQFG
PKPIDLYQKYGVMPIGDTCTPGGGSWGWWYHADTDVQRRWKEDPDAWYEKGFSDAANNVK
RIHDAAWDKGRPVSQVFSTISSDEPMVPLIEALACDIPRVVIVNTLNDHEYVQGVPRDFE
VEIPAYVSKRGIQGIQTKPLPKPVLNHMLHDRIAPVETELCAFSQRSRELLIQLIMMDPY
TKSREQAEGFLKELFELPYLKEMKEYYK

Enzyme Prediction     

No EC number prediction in MGYG000001748_01010.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	4	178	4e-47	0.9553072625698324

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	2.09e-115	3	438	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	2.04e-81	1	442	2	438	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
cd05197	GH4_glycoside_hydrolases	1.28e-77	3	437	1	425	Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
PRK15076	PRK15076	1.25e-51	2	421	1	403	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	6.73e-42	4	186	1	183	Family 4 glycosyl hydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYH41562.1	1.74e-201	1	447	1	447
BBH19141.1	1.66e-184	3	447	2	447
BBI35842.1	1.35e-183	4	447	3	447
QTH41436.1	3.86e-183	4	447	3	447
BBH22550.1	8.96e-182	4	447	3	447

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1OBB_A	4.72e-98	2	447	3	477	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]
7BR4_A	1.11e-70	3	448	13	479	ChainA, Alpha-glucosidase, putative [Thermotoga maritima MSB8]
6KCX_A	1.60e-70	3	448	13	480	Crystalstructure of citrate complex of alpha-glucuronidase (TM0752)from Thermotoga maritima [Thermotoga maritima MSB8],7CTD_A Chain A, Alpha-glucosidase, putative [Thermotoga maritima MSB8],7CTL_A Chain A, Alpha-glucosidase, putative [Thermotoga maritima MSB8]
3U95_A	5.36e-70	3	448	1	468	Crystalstructure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_B Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_C Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_D Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_E Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_F Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359]
7BRF_A	4.75e-69	3	448	13	480	ChainA, Alpha-glucosidase, putative [Thermotoga maritima MSB8],7CTM_A Chain A, Alpha-glucosidase, putative [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O33830	8.24e-99	2	447	3	477	Alpha-glucosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=aglA PE=1 SV=2
O86960	4.53e-95	2	447	3	477	Alpha-glucosidase OS=Thermotoga neapolitana OX=2337 GN=aglA PE=1 SV=2
Q9AI65	1.22e-25	1	418	1	425	Alpha-glucosidase OS=Erwinia rhapontici OX=55212 GN=palH PE=1 SV=2
O34645	1.79e-23	4	437	3	416	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1
D3T426	4.40e-22	3	436	11	444	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000101	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001748_01010.