CAZyme Information: MGYG000001806_01344

Basic Information

• Species: Prevotella sp900553965
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900553965
• CAZyme ID: MGYG000001806_01344
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000001806_39|CGC1	42727.91	8.0922

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001806	3097082	MAG	Denmark	Europe

• Gene Location: Start: 9582; End: 10703 Strand: +

Full Sequence      

MKKLITLLTVAAMALPSAAQNEKQTEVLNVARSANDYFMAKYADPTEPTNVKRIRPSSLW
TRAVYYEGLMALYGIDKQQRYIDYTDTWASFHQWTPRNGIKTRDADDQCCGQTYLERFVM
TGDSTMLRPIRENLQGQMAETKIGYWTWIDAIQMAMPIYAQMYKITGDRAYLEHGMKMYR
WSRNECGGGLFNEKDGLWWRDADYVPPYKEKDGKDCYWSRGNGWVLAALVRVMDQLSPKD
KVYKEVKKDFLMMCEGLSKCQREDGFWNVSLVSPVTYGGKETTGTALFLYGISWGLQKGY
LKEKIYRPIADKAWEAMVKDAVHKDGFLGYVQGTGKDPSAGQPVTYDKVPDFDDYGVGCF
LLGAVEYYKLLGK

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	55	369	7.4e-78	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.51e-87	30	371	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	4.19e-43	60	371	36	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS85005.1	3.34e-188	1	373	1	368
QVJ80547.1	6.29e-186	2	370	3	385
AGB29883.1	1.22e-180	1	371	1	370
QIU94559.1	1.25e-150	5	370	11	379
QNL41150.1	1.54e-150	4	370	13	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	3.06e-62	26	371	32	375	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	9.41e-62	17	371	1	358	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	4.81e-38	39	370	33	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
3K11_A	6.73e-11	148	371	200	414	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF04	5.88e-39	30	366	60	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	5.79e-38	7	370	6	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	3.03e-37	60	370	58	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000487	0.998538	0.000323	0.000230	0.000206	0.000182

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001806_01344.