CAZyme Information: MGYG000001806_01838

Basic Information

• Species: Prevotella sp900553965
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900553965
• CAZyme ID: MGYG000001806_01838
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410	MGYG000001806_71|CGC1	47624.84	5.1239

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001806	3097082	MAG	Denmark	Europe

• Gene Location: Start: 5563; End: 6795 Strand: -

Full Sequence      

MKRNSLLIIFLLAVMTVAWASRKQKNAFVHVEGKNLVRPDGTQLFIRGTNLGNWLNPEGY
MFGFKRTNSAWMIDLMVREAVGPDFAADFWRDFKDNYVTADDIRFIASQGANTVRLPFNY
KLFTDEDYMGLTAAQDGFARVDSVVKWCRDNGLYLILDMHDCPGGQTGDNIDDGYGYPWL
LESEQSQRLFCEIWRRIAGRYRDETVILGYELMNEPVAHYFDNKAELNAKLEPLYSRATA
AIREVDRNHVILLGGAQWNSAFDMFTDWTFDDNLMYTCHRYGGSATREAIQSFIDFRDKT
GLPMYMGEIGHNTDEWQADFVSVMEDANIGYTFWPYKKVDGSCMNAVVRPEEWDSVIVRF
AEADRSTFEDIRRARPDQEKARRLLREFVENTKFERCKPQEGYIRSMKLR

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	86	340	9.8e-99	0.9844357976653697

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	8.27e-38	93	334	20	266	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	8.03e-19	95	272	71	246	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam01229	Glyco_hydro_39	0.008	138	248	76	190	Glycosyl hydrolases family 39.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADX05696.1	3.31e-213	1	407	2	408
QVJ80218.1	1.95e-207	9	407	6	406
QUT37277.1	7.33e-199	26	407	33	413
QUU01283.1	1.08e-198	26	407	33	413
QUT61450.1	1.08e-198	26	407	33	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	5.04e-29	89	350	20	329	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	1.32e-28	89	350	20	329	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
1H4P_A	3.08e-15	46	283	13	249	Crystalstructure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
3AMC_A	2.63e-12	138	336	73	288	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
4LX4_A	9.37e-12	97	334	38	283	CrystalStructure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],4LX4_B Crystal Structure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],4LX4_C Crystal Structure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],4LX4_D Crystal Structure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],6R2J_A Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501],6R2J_B Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501],6R2J_C Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501],6R2J_D Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
W8QRE4	5.30e-38	27	339	2	340	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
A3DJ77	1.05e-28	89	350	20	329	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P23340	1.05e-28	89	350	20	329	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
P0C2S3	5.24e-28	89	350	20	329	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P16169	7.53e-20	46	281	8	202	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000382	0.998657	0.000396	0.000175	0.000175	0.000162

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001806_01838.