CAZyme Information: MGYG000001818_00482

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; QAKW01; HGM12957
• CAZyme ID: MGYG000001818_00482
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397		44688.87	5.836

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001818	1547538	MAG	Denmark	Europe

• Gene Location: Start: 46; End: 1239 Strand: -

Full Sequence      

MKKIKFGVIGLGQRGKGLLKVILMNMPTVEVTAVCDLYEDRVREGIDIVKEADGRTVYGT
TDAEELIHRADVEAVFIYSAWESHVPLAIECMKASKPVGVEVGGAYSVEQCWELVYAYEQ
TKTPAMLLENCCYDRRELMVLNMVRQGLFGEIVHCEGGYCHDLRDEISEGEQRRHYRLRN
YLARNCENYPTHELGPIAKVLNINRGNRFVKLASFASKSAGLNEYINANMPDNQKLKNAH
FAQGDVVTTVITCAGGQTIRLTLDTTLPRYYSRQFTVRGTKGMYEEVTDSVYLDGDGKHS
KWKEEWGNGKAYAEKYDHEIWKKYLSNGVQGGHGGIDWLVMNDFVDSLTENRPCPIDVYD
MASWMCVSALSEKSIALGGAPVDFPDFTNGAWLLNKI

Enzyme Prediction     

No EC number prediction in MGYG000001818_00482.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	1	392	9.8e-150	0.9849624060150376

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	2.30e-18	1	162	1	158	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.06e-07	4	115	1	106	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG0460	ThrA	1.79e-04	1	111	1	99	Homoserine dehydrogenase [Amino acid transport and metabolism].
COG1712	COG1712	3.90e-04	4	109	1	98	Predicted dinucleotide-utilizing enzyme [General function prediction only].
PRK06349	PRK06349	0.001	1	75	1	76	homoserine dehydrogenase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31207.1	1.10e-183	1	393	1	396
QBE96673.1	1.23e-177	1	394	1	391
QIB57148.1	5.00e-177	1	394	1	391
QMW80076.1	5.00e-177	1	394	1	391
QTH43530.1	1.34e-170	3	396	4	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	6.91e-95	2	392	19	431	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	1.06e-77	3	392	42	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8G1	9.62e-98	4	393	53	460	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A6LB54	1.28e-97	3	393	49	458	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Q8F7	3.78e-94	2	392	19	431	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	2.85e-93	2	396	32	445	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4FN60	2.21e-84	4	392	61	446	Glycosyl hydrolase family 109 protein OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=SACE_6314 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001818_00482.