CAZyme Information: MGYG000001827_01409

Basic Information

• Species: UMGS929 sp900546875
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-314; UMGS929; UMGS929 sp900546875
• CAZyme ID: MGYG000001827_01409
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
813	MGYG000001827_28|CGC1	90543.49	6.0501

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001827	1794009	MAG	Denmark	Europe

• Gene Location: Start: 4295; End: 6736 Strand: +

Full Sequence      

MDIKQLLTRLTTEEKAALVAGRDFMFTNPVPGSGISSLRMSDGPHGLRVQDEGGDNGVTG
SSPATAFPTAATVACGWDPENSYKIGRAIGREARKYGVNVVLGPGANIKRNPLAGRNFEY
FSEDPLLSGKLAAQEVKGLQSKGVGACVKHFALNNAENYRFMGNSVADMRAIREIYLKVF
EIIVRESRPAAMMCAYNMINGEYCSQNRWLLTEVLRREWGFEGAVMTDWGAMHDRIASLE
AGLDLEMPGDTAICRKWITDGIASGELSEETLDAAVENVLKLVERYAKEYAEECDFEADD
RLSAEVAKDCAVLMKNDGFLPLDEKEEVFVCGELFEKMRYQGAGSSMINPFRLTSPEKAF
DEMGVKYVYARGYKENETTVTLKYIEEAKKRSEKYGKAVVFAGLTDYVESEGCDRENMKL
PENQIALIESLIGAGKEVAVVLFGGSPVELPFEGRVKAILNMYLPGQSGGRACAELLFGR
ADPSGRLAETWPLKYEDVPFGSSFSKTEREVYKESVYVGYRYYTTAGKKVRFPFGYGLSY
TKFDYSDMTTDTEGEDIRVSCEVVNSGCRDGAEVVQLYVKTPENNTFHPVRELRAFEKIR
LKAGERRRVEFTVKKSDLKYYDTVLKNWAVESGDYEFEICRDCNSVVFSRRVKIRGEGGA
KCPEDIMRAYRGAEFNGLDDEVFERAAGIKIPPLSGLKPITLESRFSVFSKVGVIGRLLY
SAVINVSVKEMKKAKKLPEGTERDNKIKGALFLKRVMESNSLMSMTMCAGKSFPYNFAQG
FMFLANGKILKGIKCFCTEVKASALPKDKDREV

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	248	6.5e-68	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	6.35e-85	65	653	118	758	beta-glucosidase BglX.
COG1472	BglX	5.11e-69	1	326	5	354	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	7.57e-59	6	613	56	742	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.38e-51	311	540	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	6.02e-44	39	282	58	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF24834.1	9.16e-283	1	810	1	711
AHF25260.1	8.88e-278	1	809	24	732
AHF25921.1	1.57e-249	1	809	1	708
QYH55292.1	8.53e-224	3	810	9	825
QNO38010.1	1.88e-218	3	796	9	803

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	9.64e-196	1	654	3	668	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	7.46e-145	10	660	12	669	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	5.82e-134	3	656	4	709	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	8.88e-133	3	656	4	709	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	9.48e-101	2	657	5	839	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	5.28e-195	1	654	3	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	6.82e-144	10	658	12	676	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	5.30e-143	10	658	12	676	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
Q0CAF5	2.35e-111	1	639	4	816	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
B8NDE2	9.68e-109	1	635	4	812	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001827_01409.