CAZyme Information: MGYG000001912_00246

Basic Information

• Species: UMGS1839 sp900555545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1839; UMGS1839 sp900555545
• CAZyme ID: MGYG000001912_00246
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
715		78944.29	4.6775

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001912	1976012	MAG	Denmark	Europe

• Gene Location: Start: 1969; End: 4116 Strand: +

Full Sequence      

MRQNSKKQSTHTGKKRTGQAASSGSAGTKKWTLKVVLLTVLAILVLTAVAVVIYVGVNMV
KVVYGDLVVNLDEYKANQNQTTIVYGKNAANEDVEIARLHGTENRIWVSLDDMPDELGEA
AIALEDKRFPKHHGVDWFRTISVIVRNTDSGGSTITQQLIKNLTGNREVTYSRKYNEILS
ALNLERYYDKNIILEAYLNTLYLGEGCYGVKTAAEVYFGKDVSELNAAECACLVSITQKP
TLYDPLINPEDNRERQLDCLEKMYEEGYLTEQEYNEAVDYKMVFTNSPDYVADGDETQDT
VVQEVQSYYVDYVIDEVIDDLCQLQGYTESQATDMIYYGGLKIYTAVDVDVQAAMEEVFT
SRSGMDHSGTQAGMAVMDYSGRIVGLVGGAGEKTDRRGLNRATDIQRQMGSSIKPLSVYG
PGIDTGKIYWSSIYEDSPIYKYGELWPEQNAGGGYSSSKMTVQYGLQHSINMIAGRVLDT
IGLDTSYEYATNNFALPLHSNDKDWSPLAMGSTYYGVSPLDMAAAFATFGNGGVYYEPYC
YYKVTDRTGKKIYLETESESHQAISAGTADVMNELLQTVVSGGTGNGYAVSGFQTFAKTG
TTNDNKDRWFCGGTPYYVGAVWYGYDVPENLGSTSSPNKIFKNVMDRIHEGKDAKTFTKS
KESEQKEYCTVTGLLASDKCTSKQKGWYVKGKEPAVCTQCGGVPAEGSTTPQVQQ

Enzyme Prediction     

No EC number prediction in MGYG000001912_00246.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	96	264	1.8e-58	0.9717514124293786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	2.58e-164	104	651	1	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	5.34e-153	21	661	1	609	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	5.21e-123	29	695	3	765	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	4.82e-67	96	264	5	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG4953	PbpC	1.28e-61	105	694	58	602	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI59848.1	2.67e-162	56	697	61	736
CAB1249043.1	2.48e-156	57	696	52	700
QEY34222.1	2.39e-147	72	697	62	700
AUO18445.1	5.70e-142	69	686	41	667
QNK41697.1	6.20e-142	69	697	64	704

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	5.82e-66	91	694	27	807	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3ZG8_B	4.78e-62	184	636	3	446	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	2.86e-57	184	636	3	446	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
3DWK_A	5.64e-57	84	655	10	597	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	1.17e-53	84	655	19	606	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5I6G4	1.21e-83	103	649	74	644	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	1.21e-83	103	649	74	644	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A7GHV1	3.05e-83	103	649	74	644	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
Q0SRL7	3.61e-80	79	694	69	717	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1
Q891X1	2.08e-79	77	703	56	716	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999823	0.000191	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
35	57