CAZyme Information: MGYG000001956_00261

Basic Information

• Species: Eubacterium_R sp900543795
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900543795
• CAZyme ID: MGYG000001956_00261
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
565	MGYG000001956_3|CGC1	64743.45	8.2115

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001956	1751837	MAG	Denmark	Europe

• Gene Location: Start: 89216; End: 90913 Strand: -

Full Sequence      

MIATEFSKNIDKNNPLSEYPRPQFVRSSYINLNGVWQCEFSEKKEFPKNYSYNIVVPFSP
ETALSGVGRTLKSNEYLFYKRSFEIPQGFNKGRVFLHFGAVDQIAEVFVNSSFAGSHTGG
YTPFTLEITDYIANGTNELDVRVRDYTDNGEYSRGKQKTKRGGIWYSAQSGIWQTVWLES
TPKEFLKSVRITPDYDNEQVSFEYFGTDNVTVSVYDGKSLIAQTNDKTVKIPDFKPWSPE
SPFLYDVVFEACGERIKSYFGMRKFSVGADSNGIKRLFLNNKPYFQNGLLDQGYYPESLL
TPPSNSAMEGDIKTVKELGYNMLRKHIKIEPLLWYHYCDVNGIIVWQDMINGGGNYGAEV
SVLPFLNIKLNDANYKTFKRTDEAQRKSYYNELCEMITALYNCPCIAAWVPFNEGWGQFD
SAKAYNYIKSIDKTRIVDSASGWHDQGVTDVISKHIYFTPIIVKAAGKPYVLSEFGGFSQ
RIKGHTFNNKMFGYKIYSSKEKLTGAYKRLFEKTIIPQIKTGLCACVYTQLTDVEDELNG
IMTYDRKIIKIDEETVKRINERMKI

Enzyme Prediction     

No EC number prediction in MGYG000001956_00261.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	23	463	7.9e-95	0.5146276595744681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	2.29e-29	19	438	3	440	beta-D-glucuronidase; Provisional
COG3250	LacZ	1.64e-26	27	437	10	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	3.03e-21	27	476	39	514	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	5.41e-13	27	182	31	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
PRK09525	lacZ	2.97e-11	109	452	147	500	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOH43755.1	1.09e-196	2	560	1	566
AWB85883.1	2.02e-190	2	563	3	579
QHQ59405.1	2.97e-190	2	561	22	598
AEC02401.1	2.97e-189	15	565	32	592
QKW37630.1	3.17e-189	2	563	3	577

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.62e-139	2	563	12	582	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6S6Z_A	7.15e-22	18	475	33	507	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	7.15e-22	18	475	34	508	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6D8K_A	6.68e-20	77	349	100	371	Bacteroidesmultiple species beta-glucuronidase [Bacteroides ovatus],6D8K_B Bacteroides multiple species beta-glucuronidase [Bacteroides ovatus],6D8K_C Bacteroides multiple species beta-glucuronidase [Bacteroides ovatus],6D8K_D Bacteroides multiple species beta-glucuronidase [Bacteroides ovatus]
6NCW_A	1.47e-19	79	509	58	501	Crystalstructure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_B Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_C Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_D Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCX_A Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_B Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_C Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_D Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	3.92e-21	18	475	34	508	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P77989	4.76e-19	31	491	18	470	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	6.12e-17	79	414	107	430	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P23989	8.56e-16	13	475	61	512	Beta-galactosidase OS=Streptococcus thermophilus OX=1308 GN=lacZ PE=3 SV=1
Q7WTB4	9.34e-14	7	540	71	582	Beta-galactosidase large subunit OS=Lactobacillus helveticus OX=1587 GN=lacL PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001956_00261.