CAZyme Information: MGYG000001963_01758

Basic Information

• Species: Phocaeicola sp000434735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp000434735
• CAZyme ID: MGYG000001963_01758
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000001963_38|CGC2	43007.01	6.109

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001963	3288738	MAG	Denmark	Europe

• Gene Location: Start: 34098; End: 35237 Strand: +

Full Sequence      

MERIKTAFIGFGYRGKQLFRLAGEIPFYNIVGVADPYSDFQGVEGVACYGDGEDSYLAML
DEQKPELVFITTPWILHVSHAMECVQRHCHVALEIKGGLYADEYQPLVYLSHQNHCIVYP
LENTLFLREIQSVNRMVAEGLLGEIVYMRGGYRHDLRSLLLDDNGKLGRRSGESVWRSGY
YLSRNCDMYPTHGFAPLCMIGGIGKTDRLTCLTSFASKAVGLRHKMKELSGSDANIPHIA
TGDIITTQIETRHGVLVSLVHDTTLPRPRSLDFEVQGTKGVWKGNERLIYIEGVSAEERW
EDDAFYVDKYESDYWKRWGQKAIQCDSHHHGMDYIMLKAVEVDQKGEIPYPASLQDLALW
TSVTILSDISIKENRKVDL

Enzyme Prediction     

No EC number prediction in MGYG000001963_01758.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	1	376	3e-96	0.9548872180451128

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	5.98e-14	1	309	1	277	Predicted dehydrogenase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT33801.1	5.58e-172	1	379	1	378
QQA30653.1	5.58e-172	1	379	1	378
QUT62197.1	5.58e-172	1	379	1	378
ADV42950.1	6.17e-168	4	379	10	384
QRO24037.1	1.00e-128	1	379	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	8.55e-67	2	377	19	420	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	1.33e-38	1	373	40	423	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	4.68e-66	2	377	19	420	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	1.60e-56	2	371	32	424	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4Q8G1	6.67e-54	49	371	108	442	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A6LB54	1.48e-49	3	371	49	440	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4FN60	1.80e-49	2	374	59	432	Glycosyl hydrolase family 109 protein OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=SACE_6314 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001963_01758.