CAZyme Information: MGYG000001995_01076

Basic Information

• Species: Parabacteroides sp900541965
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900541965
• CAZyme ID: MGYG000001995_01076
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377		42931.83	8.4965

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001995	4648473	MAG	Spain	Europe

• Gene Location: Start: 29823; End: 30956 Strand: +

Full Sequence      

MKYFLIAGEASGDLHASNLMAALKEQDAEADFHFFGGDLMQAVGGTLIKHYREMAYMGFI
SVLLHLRTILNNMRICEKEIKAYHPDVVILIDYPGFNLKIAKFVKTQLGLPVYYYISPKI
WAWKQYRIKDFRRYVDRMFCILPFETDFFKKLNYAVDYVGNPSVDSVAQFKEQQAVLPDV
FIKDESLSGKPILALLAGSRKQEIKDNLPVMLEVAAAFPEYEPVIAGAPGLEPEYYRQYI
GNSQAKIVFGKTYLLLQHSKVALVTSGTATLETSLFRVPQAVCYYVPAGTLASFIFKHFF
HTPYISLVNLIAGREVVQELFGARFSQQQIHDELYQIIHNASYRNSMLEGYDEVIRLLGK
PGASKRTAELIYRSLKH

Enzyme Prediction     

No EC number prediction in MGYG000001995_01076.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	357	3.7e-111	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.14e-104	1	376	2	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.24e-90	1	371	2	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	5.12e-71	4	366	2	366	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.99e-60	5	369	10	380	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.58e-47	1	372	2	345	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50508.1	9.63e-226	1	377	1	377
BBK92630.1	2.92e-220	1	375	1	375
QUR47916.1	2.92e-220	1	375	1	375
ABR44355.1	4.83e-219	1	375	1	375
QRO15504.1	4.83e-219	1	375	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	9.30e-37	5	354	11	361	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	9.30e-37	5	354	11	361	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.38e-65	2	375	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	1.54e-60	5	376	8	379	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q6ALW0	3.23e-56	2	370	11	381	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q39T49	2.36e-55	2	375	8	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
A9NCA7	2.92e-54	5	372	8	371	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000012	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001995_01076.