CAZyme Information: MGYG000002007_00824

Basic Information

• Species: Alistipes dispar
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes dispar
• CAZyme ID: MGYG000002007_00824
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
846	MGYG000002007_2|CGC4	94248.6	4.692

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002007	2708946	MAG	Spain	Europe

• Gene Location: Start: 307167; End: 309707 Strand: -

Full Sequence      

MTRTRFALLAAGLLLCGPLSGQETDFDLAAQRSESQDVRPVPGHAVDHGGLPLNPVPHSL
VRGEGRLDVSGGVRLRGEGARFAADLGFLPLARKGAALSVEFGAKAAARRGVKPLSGAYA
LRIDGSGIALTGYDERGAFYAVQTLRQIAESPAAAGGLPFVEIADYPDLPTRGVVEGFYG
TPWPHAVRLSLIDFYGRFKMNSYLYGPKDDPYHSCPDWRLPYPEPEARQIRELVEACRRN
YVDFVWAIHPGQDIRWNEEDYRNLVQKFEWMYDLGVRAFAIFFDDISGDGTDPERQTELL
NRLDADFVRAKGDVAPLVVCPTDYSRLWANPTPQGSLAIYGRTLDPSVRVFWTGDVVCSD
LTPETLAWVDSRIGRPAFYWWNYPVTDYARHILMQGPVYGLDTTLTTDDLCGFVSNPMEH
GEASKLALYGVADYTWNTAAYNPIDNWERGLAELVPEAREAYRTFAIHSCDTETGYRRDE
SWETETFRIADYTPGQAAALREEFERVVAAPGVLEERCANRELLAELRPWLAEFRKLGER
GLRTLDLIACYETGDDAAFWSGYVRNRMSAADRSAYEAHKSGTMKLQPFYEQAMDDMAAG
FFTRLTGDRPASARGIGSFPTLATTQSRLMLDHDPGTFYTSGRAQQAGDWIGVDLGTLRE
VSEVTILQGRNSTDDVDYFDHARLEYSADGRTWHPLLDDLRRQYVVEWSGEPVGARYVRL
LRLDSPRTNWAAVRSFEVNPVRAERLGFRVEAADAERALYAFDRDPGTSFRSDGRLAFEV
PDGVREYVLLLDLPGEDGLRVRQLAADGSVLSETAVGEPFFRLALADGAASVALEGPAEV
FEIIAR

Enzyme Prediction     

No EC number prediction in MGYG000002007_00824.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	172	466	3.9e-103	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	7.63e-160	172	465	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	7.58e-15	55	165	6	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
pfam00754	F5_F8_type_C	1.19e-10	628	720	15	110	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	2.20e-08	650	738	47	141	Substituted updates: Jan 31, 2002
COG3525	Chb	5.43e-06	40	226	111	316	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL05673.1	0.0	1	846	1	846
AHF11939.1	0.0	10	844	12	852
BCI62100.1	0.0	11	844	15	852
ADV43394.1	0.0	15	846	16	849
ALB75783.1	0.0	14	845	18	851

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MI4_A	7.96e-147	119	548	92	527	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]
2J4G_A	1.11e-146	119	548	80	515	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2JIW_A	1.14e-146	119	548	81	516	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]
2CHO_A	1.14e-146	119	548	81	516	Bacteroidesthetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482],2CHO_B Bacteroides thetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	1.14e-146	119	548	81	516	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	1.15e-145	119	548	102	537	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	5.97e-89	119	725	133	746	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	8.24e-89	119	725	133	746	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
P26831	4.10e-48	128	739	143	795	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	1.83e-33	150	444	40	339	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000756	0.627762	0.370524	0.000388	0.000309	0.000237

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002007_00824.