CAZyme Information: MGYG000002033_00982

Basic Information

• Species: Parabacteroides massiliensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides massiliensis
• CAZyme ID: MGYG000002033_00982
• CAZy Family: GH97
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1261	MGYG000002033_8|CGC2	141383.01	5.7398

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002033	4100607	MAG	Spain	Europe

• Gene Location: Start: 50519; End: 54304 Strand: +

Full Sequence      

MNTRFVTFILLLFLGMNNVCAQSQPELYRIFSPDKKSVMAVQRHNDGSLTYTFTADGEML
IKESPLGFKLESQETVPSSGWKIEGVSDRQVRDEWRPLWGKRAVVEDHFNESVIDLQNPA
GQPKRMQLVVRGYNDGFAFCYKIPEGEGERVDVQSELTAYNFAGDYTAWFYNGENHNIGP
EKLTETDGTRLPVMTVKAGDKHYMAIHEACLETGAPLVLQSKGGESLFSVASKPACLSPG
YTSAWRVVLHGATPGALTDSHLLELLNPDPDPRYDFSWVKPGLAVWDWRINGAVWDGFTY
EMSYPSWVRMVDFAAEQGFKYLVLDANWYGPEFESDSDPVKGEKAQDVQRLLKYGKEKGV
GIWLYLNDVGGRKYPIEKTLKQYGDWGAAGVKYGFMSGTQEEKNLWTKKITELCAQNHLL
VDFHDGPVHPYGQMRTWPNAVTREYCHAQLDGHHVFEPKTFVTTVFVNMVAGPVDMNNGM
FDLRQGHTTRVDESQPVPSTLVSEAARTLITFSGVTILPDIPEYYRKYPALLNFLSAQKM
PWKESRTLAGEIGEYIVMMRETDEAYLVGAATNESGRTIELPLSFLKEGTYTVEVIEDGE
DAHYLTNRESLKVATRQLTNNDKLTLKLAPGGGACLVIKKNSSMGTCEQATFPLASPSGK
MNAEIKVGGKNVEIDLFDDGEKVVTAKTLQFSLDENILKGNWKVADQKRESVDQTWQPVY
GERAVVTDRYNEVELTLQSDENRKEMALSVRLYDEGLAFRYAFDKLDFWNRTVTDEKTQF
LFQEDCKTWVTGMAQGAYSETKLSALKGTADRPQVIQVNDNRFVAIGEAALVDYSRMKLE
KSETGFGVQSALSGKVNLDLAGYRSPWRYVMVAGHPGKLVENNYIILNLNEPNQIANTSW
IKPGQVIREVTLTTAGSMACIDFAAENNIAYVLFDAGWYGAEGDVKSDATTVTVDPARSK
GPLDLPKVIEYANSKGVGILVYVNQKALHQQLDEILPLYKKWGIKGVKYGFVNVGDQYAT
AWLHQAVRKAAKYGLMVDIHDEYRSTGYSRTYPNLLTQEGIRGDEESPSLDQAIYTLYNR
MICGAGDYTNCYFAERVTEKMGGRAAQLAKLVAIYSPWQFVYWYDRPEKSPRRAGGAGSA
ESVIKTDAATRFYNSIPTVWDETRFLEGEMGKYAVVARRSGPDWYVSMLNAGDKRQISLP
LDFLKNKKGYAATLYYQASEKKKDVVDIKKIKLDSRNEVTIGLSGNSGCVLHLRQEISGQ
Q

Enzyme Prediction     

No EC number prediction in MGYG000002033_00982.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	649	1253	4.5e-151	0.9809825673534073
GH97	22	638	1.3e-143	0.9809825673534073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14508	GH97_N	2.58e-58	656	892	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam10566	Glyco_hydro_97	1.18e-52	898	1128	2	262	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	1.62e-50	32	268	1	234	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam10566	Glyco_hydro_97	8.67e-49	275	536	1	275	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14509	GH97_C	1.85e-34	542	639	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68310.1	3.28e-307	11	640	6	631
BBE16916.1	4.35e-299	3	640	4	638
QUT75478.1	7.26e-298	1	641	1	641
QUT49475.1	1.70e-284	257	661	1	405
ABQ06816.1	1.96e-261	3	640	5	613

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E1Q_A	1.12e-57	656	1215	20	614	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
3A24_A	7.12e-57	656	1215	6	600	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5HQB_A	2.38e-54	32	639	5	659	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
3WFA_A	1.13e-49	698	1255	72	705	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	1.15e-49	698	1255	81	714	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	3.51e-58	649	1215	20	621	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	1.36e-53	21	633	28	615	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
G8JZS4	7.15e-49	698	1255	92	725	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000240	0.999095	0.000182	0.000166	0.000157	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002033_00982.