CAZyme Information: MGYG000002052_00835

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Stomatobaculum
• CAZyme ID: MGYG000002052_00835
• CAZy Family: GT1
• CAZyme Description: Oleandomycin glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347		38958.13	9.7097

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002052	1357580	MAG	China	Asia

• Gene Location: Start: 27; End: 1070 Strand: +

Full Sequence      

MEASGARFVPYDVPPHTCVSALNEVLNWGAAYRTVRRIGANYDCLIYELLFFPGKALAAE
LGIPSYRLISTFALNRNLLRVLGQTGGPYLTALFRSERLCTALSRLFLPKFSLRENNLAE
ALVSEAPPHNFIYTLRDFQPEEACFPETKYHFVGPAVEDRAEEPFSFGESENPIVYISFG
TLMHADKRFWKRLIAAFAGRRVEVICAVGSEKLVRSLGDLPQNVRVYARVPQLTVLRRAS
LFVTHGGMNSVNEALYYGVPMIVIPFGLDQPLVGRELARRKLGRVIAPRELTAARLWRTA
KDLRRDPEAREARIAMKRKMQASGGNLEVAKCILEDLAAREAGRRAE

Enzyme Prediction     

No EC number prediction in MGYG000002052_00835.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	63	335	4.4e-44	0.6649214659685864

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01426	MGT	2.64e-55	2	339	39	392	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
cd03784	GT1_Gtf-like	7.54e-44	37	324	97	393	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
COG1819	YjiC	5.76e-43	54	345	121	406	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
PHA03392	egt	6.09e-14	169	311	293	437	ecdysteroid UDP-glucosyltransferase; Provisional
cd03785	GT28_MurG	2.29e-12	144	324	141	339	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFG41768.1	2.24e-98	1	337	49	385
BAQ23595.1	3.61e-97	1	337	49	385
BAH87358.1	1.40e-96	1	337	48	384
QFG43508.1	1.45e-96	1	337	49	385
QZS43768.1	1.45e-96	1	337	49	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQW_A	3.71e-33	43	325	101	373	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	4.03e-33	43	325	101	373	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
5DU2_A	3.72e-29	1	341	69	418	Structuralanalysis of EspG2 glycosyltransferase [Actinomadura verrucosospora],5DU2_B Structural analysis of EspG2 glycosyltransferase [Actinomadura verrucosospora]
6J31_A	9.37e-28	43	339	102	396	CrystalStructure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6J32_A	9.75e-28	43	339	105	399	CrystalStructure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31853	5.35e-38	41	335	100	394	Uncharacterized UDP-glucosyltransferase YojK OS=Bacillus subtilis (strain 168) OX=224308 GN=yojK PE=3 SV=2
Q65JC2	8.97e-36	43	325	105	378	NDP-glycosyltransferase YjiC OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=yjiC PE=1 SV=1
O34539	2.21e-32	43	325	101	373	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1
O05496	1.60e-30	41	308	97	361	Uncharacterized UDP-glucosyltransferase YdhE OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhE PE=3 SV=2
Q53685	2.51e-25	43	340	106	401	Oleandomycin glycosyltransferase OS=Streptomyces antibioticus OX=1890 GN=oleD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002052_00835.