CAZyme Information: MGYG000002131_02169

Basic Information

• Species: CAG-882 sp900545455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-882; CAG-882 sp900545455
• CAZyme ID: MGYG000002131_02169
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319		36684.79	5.0921

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002131	2861336	MAG	United States	North America

• Gene Location: Start: 4172; End: 5131 Strand: -

Full Sequence      

MITTPCNPHAIKEVKNVIEYLGEIEGKGIITGQHTQTMEQEELLKIQKVTGKLPALCGFE
LLSYSPNIKLETASAACVTEVMRNKGTLNKAWEWAQKGGLITFTWHWFSPLGGRDKSFYS
ENTDFDAGRALLEGTPEHIAMCNDLDYMASLLQPFCEKNIPILWRPFHESEGSWFWWGAK
GTDTARELYRFMYHYYTEKYQLDNLIWVWNSPLAEGYVGDNYCDIISRDIYPPAYAYGDF
KSEYDDLKNITAAHKGAALAESGILPNVKKLADTKVPWLWYMIWSGAFVLTENYNEYVVL
KELYNHDYAITLDKLPKLY

Enzyme Prediction     

No EC number prediction in MGYG000002131_02169.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	7	313	7.8e-92	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.94e-51	7	313	2	310	Glycosyl hydrolase family 26.
COG4124	ManB2	1.54e-12	159	287	179	324	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ66101.1	3.84e-151	5	319	10	325
AIQ67637.1	2.13e-150	4	319	8	324
CQR54080.1	3.03e-150	1	319	5	324
AZK45707.1	5.48e-150	1	319	2	321
QUL56288.1	1.00e-148	5	319	9	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	6.37e-61	7	315	147	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	3.67e-56	3	315	4	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	2.71e-44	3	316	32	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	1.16e-40	6	284	46	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	1.29e-36	5	315	23	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	5.72e-60	7	315	176	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	3.83e-49	26	316	167	458	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
Q5AWB7	6.62e-46	3	315	26	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
A2R6F5	1.84e-43	10	313	33	331	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55298	8.31e-42	4	316	155	460	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002131_02169.